(data stored in ACNUC7421 zone)

EMBL: CP000251.PE328

CP000251.PE328       Location/Qualifiers
FT   CDS_pept        388359..388610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80106"
FT                   /db_xref="GOA:Q2IMS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80106.1"
FT                   /translation="MDRLKQLKIQISLQWYELILIGVTAGLLAFGVWALIDTLLISSPV
FT                   AAWRFLALFVIWSLPGIAVLAFVRPRTAAEAAQEQPTP"
     atggaccggc tcaagcagct caagatccag atctcgctgc agtggtacga gctgatcctc        60
     atcggcgtca ccgcgggcct gctcgccttc ggcgtatggg cgctgatcga cacgctcctc       120
     atctcgtcgc cggtcgcggc ctggcgcttc ctcgcgctgt tcgtcatctg gtcgctgccg       180
     ggcatcgcgg tcctcgcgtt cgtccggccg cgcaccgccg ccgaggcggc gcaggagcag       240
     cccaccccgt aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page