(data stored in ACNUC7421 zone)

EMBL: CP000251.PE332

CP000251.PE332       Location/Qualifiers
FT   CDS_pept        392407..393036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0334"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80110"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80110.1"
FT                   /translation="MLRSPVFLSALTFLAVALGVRAAQAPWREQFPGSYPRVVAPAEAR
FT                   FEFLPDELRIHLSDQTRSGRIIVFAHVEGGSLLGLLKPIVDGTVTVRRGDLADYALAIH
FT                   GGEIGEHRLLKAMDRYVEREDMLERILEARAKGLRFGVQRCLYPICNRCLDGCKSVMRR
FT                   DYPISMRVGERGNVEPGFAKGSCPRCGKCFVWCPSGVLRDSGSLTN"
     atgctccgta gccccgtctt cctgtccgcc ctgacgttcc tggccgtcgc gctcggcgtg        60
     cgcgccgcgc aggcgccgtg gagggagcag ttccccggct cctatccgcg ggtggtggcg       120
     ccggcggagg cgaggttcga gttcctgccg gacgagctcc ggatccacct gtccgaccag       180
     acgcgcagcg gccggatcat cgtgttcgcg cacgtggagg gcggcagcct gctcggcctg       240
     ctgaagccga tcgtggacgg gaccgtcacg gtgcgccgag gcgacctcgc ggactacgcg       300
     ctcgcgatcc acggcgggga gatcggggag caccggctcc tcaaggccat ggaccggtac       360
     gtcgagcggg aggacatgct cgagcggatc ctcgaggcgc gcgcgaaggg cctgcgcttc       420
     ggggtccagc gctgcctcta cccgatctgc aaccgctgcc tggacggctg caagagcgtg       480
     atgcgccgcg actaccccat ctccatgcgc gtgggggagc gcgggaacgt cgagccgggg       540
     ttcgcgaagg gcagctgtcc gcggtgcggg aagtgcttcg tgtggtgtcc gtctggcgtg       600
     ctccgggaca gcgggtccct caccaactag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page