(data stored in ACNUC7421 zone)

EMBL: CP000251.PE333

CP000251.PE333       Location/Qualifiers
FT   CDS_pept        393045..393410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0335"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80111"
FT                   /db_xref="GOA:Q2IMS7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80111.1"
FT                   /translation="MLEAMEIAVVMLPVVLVAGMLVRLVARGQAQVLLCMECELCMGAC
FT                   PLCAKRGEAFPGPKGILAAAKTGKVEAAIAAGALDCTSCGACTRVCPRGLAPQVEVERW
FT                   RAAAEREGTRGAARGPA"
     gtgctcgagg cgatggagat cgcggtcgtg atgctcccgg tggtgctggt cgcggggatg        60
     ctcgtccggc tggtggcgcg cggtcaggcg caggtgctgc tctgcatgga gtgcgagctg       120
     tgcatgggcg cgtgcccgct gtgcgccaag cgcggcgagg cgttccccgg gccgaagggg       180
     atcctcgccg cggcgaagac gggcaaggtg gaggccgcga tcgccgcggg cgcgctcgac       240
     tgcacctcct gcggcgcctg cacgcgcgtg tgcccgcgcg gcctcgcccc gcaggtcgag       300
     gtggagcggt ggcgcgccgc ggccgagcgg gaggggacgc gcggcgcggc acggggaccc       360
     gcgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page