(data stored in ACNUC7421 zone)

EMBL: CP000251.PE334

CP000251.PE334       Location/Qualifiers
FT   CDS_pept        393407..395356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0336"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80112"
FT                   /db_xref="GOA:Q2IMT3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80112.1"
FT                   /translation="MSARPPSAGRTAIALACAAGPALAPALASAQEPALPAVVLDEQVI
FT                   RLPRAEAEGRPPATITVVDRSTFEGEAKDVGQLVSAAPGVVVEEHGGMGQLTTVSIRGS
FT                   TPDGVKVLLDGLPLNTAFGGGVDLSTIPRAWVDAVEVVRGPEGARYGAGALGGALNVVT
FT                   RRPSAGSWSLETGGGSYDTARVAAELAAAVGPGSLMVAASADTTGGRFPFRLDPGLPGG
FT                   PTVAAMRENAEARRAGLLAKLARPLSRGRLDALVEVSGGHRGLPGFAASPTPWAWQDDA
FT                   RLLAMGRVARFGAIGPATLATRGHLRLDRLDARVTGPRDPPVRQRGSAAGLALDATGSH
FT                   AHGVLSASLEASGELIDADGLGRRRELLGVAAAVSEDLALAGGRFRLAPAVRAERAGRF
FT                   GGVSGTLGLGARLGPALRARASVGRTFRPPGVAELHLQQGLLVPNPDLRPETAVAVDAG
FT                   LVADGRAGLVAVTGHLTRYDDLVVYEPSDAFGRLKPFNSGRAMASGLEVEGATAPVGGP
FT                   LRASARGSYTFLATELLRGAPAEVGHWIPYRPRHRAVLRAALAPGPATAHVELHHLGRR
FT                   YRDRRGVNPIPPSTVWNAGLSARVARHPDVRIQLEVLNLADDRTLTDGLGDPLPPRTVM
FT                   ITLRAGSTPQENAP"
     gtgagcgccc gtcctccatc ggccggacgg acggccatcg cgctcgcgtg cgccgccggt        60
     ccggcgctgg cccccgcgct cgcgtcggcg caagagccgg cgctccccgc cgtggtgctg       120
     gacgagcagg tcatccggct gcctcgggcc gaggcggagg gtcggccgcc ggcgacgatc       180
     accgtcgtgg accgctcgac cttcgagggc gaggccaagg acgtcggcca gctggtctcc       240
     gcggcccccg gcgtcgtcgt ggaggagcac ggcgggatgg gccagctcac caccgtctcg       300
     atccgcggct cgaccccgga cggcgtcaag gtgctgctgg acggcctgcc cctcaacacg       360
     gccttcggcg gcggcgtgga cctctccacc atcccgcgcg cgtgggtgga cgcggtggag       420
     gtggtgcgcg gacccgaggg cgcgcgctac ggcgcgggcg cgctcggcgg cgcgctgaac       480
     gtggtcacgc gccgaccgag cgcggggagc tggagcctcg agacgggggg cggctcctac       540
     gacaccgccc gcgtcgcggc cgagctcgcc gccgcggtgg ggcccggctc gctgatggtg       600
     gccgcgagcg ccgacacgac cggcggccgg ttcccgttcc ggctcgatcc agggctcccc       660
     ggcggtccga ccgtggccgc gatgcgcgag aacgccgagg cccggcgcgc cggcctgctg       720
     gcgaagctgg cgcggccgct gtcgcgcggc cggctcgacg cgctcgtcga ggtgtccggc       780
     gggcaccggg gcctgccggg cttcgccgcc tcgcccacgc cgtgggcgtg gcaggacgac       840
     gcgcggctgc tcgcgatggg gcgcgtggcg cgcttcggcg cgatcggccc ggccacgctc       900
     gcgacccgcg ggcacctgcg gctcgaccgc ctcgacgccc gcgtcaccgg cccgcgagac       960
     ccgcccgtcc ggcagcgcgg cagcgcggcc gggctcgcgc tcgacgcgac ggggtcccac      1020
     gcgcacggcg tgctcagcgc ctcgctggag gcgtcgggag agctcatcga cgccgacggg      1080
     ctgggccggc ggcgcgagct gctcggcgtc gcggcggcgg tgtcggagga tctcgcgctc      1140
     gccggcggtc gcttccggct cgcccccgcg gtccgcgcgg agcgggcggg gcggttcggc      1200
     ggggtgtccg ggaccctcgg gctgggcgcg cgcctcgggc ccgcgctgcg cgcgcgcgcg      1260
     agcgtcggcc gcaccttccg cccgcccggg gtggcggagc tgcacctgca gcaggggctc      1320
     ctggtcccga acccggacct ccggccggag acggcggtgg ccgtcgacgc cggcctcgtc      1380
     gccgacggcc gcgccggcct cgtcgccgtc accggccacc tcacccgcta cgacgatctc      1440
     gtcgtctacg agccgagcga cgcgttcggc aggctgaagc cgttcaactc ggggcgcgcg      1500
     atggcgagcg gcctcgaggt ggagggcgcg acggcgccgg tcggcggccc gctgcgcgcg      1560
     agcgccaggg ggagctacac cttcctcgcc accgagctgc tgcggggcgc gcccgccgag      1620
     gtgggccact ggatcccgta ccggccgcgc caccgcgccg tcctgcgcgc cgcgctcgcg      1680
     ccggggccgg cgacggcgca cgtcgagctt caccacctgg gccgccgcta ccgcgaccgg      1740
     cgcggcgtga acccgatccc gccctcgacc gtctggaacg ccgggctgag cgcgcgcgtc      1800
     gcgcgccacc ccgacgtgcg catccagctc gaggtgctca acctcgccga cgaccggacg      1860
     ctcacggacg gcctcggcga tcccctcccc ccgcgcaccg tgatgatcac gctgcgcgcc      1920
     gggtccacgc cccaggagaa cgcgccatga                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page