(data stored in ACNUC7421 zone)

EMBL: CP000251.PE335

CP000251.PE335       Location/Qualifiers
FT   CDS_pept        395353..396843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80113"
FT                   /db_xref="InterPro:IPR006969"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80113.1"
FT                   /translation="MRAATILGTLAVAALAACDSDATCPEGQVECAGRCVALATDPLNC
FT                   GACGVACGPGATCGAGACGCGPGTVLCGATCAQLESDPDHCGACGSACRDAQVCSSAGG
FT                   AAACADACGEGQVACGRACVELAFDRYHCGACGTVCQPGEACDAGTCRSLQVACFATDD
FT                   VRPIAPDLAAAGSPRPAGDGPIALAALGGDVWAAAALSGSVIRLPLDLSAPPVEHALHG
FT                   SDLEGIAAASDRLLVSNSGGGSVAVVDPVTGRVLDDVLIPGLPGANPRGIAVLDGKAYV
FT                   ALYGRDEASGGQGVAVLDLSRLAGCAAAPCATVERVVDLRGAADAGGLPFPGKAVAAGG
FT                   RAWITIANLARDTDPASWTYGYYVKPAGPGRLAALDGTSDAVQLVSLGDGCRNPGALAV
FT                   DGATLWVSCGAAGAAGLVPVDVSDPRAPVVGPVLATAFDAPGAVAICRGAGFVADQYTG
FT                   RVQRFDPVTRTSEETVTACPVGAQGWAWAADLLCAPAR"
     atgagagcag ccaccatcct cggaaccctc gccgtcgcgg cgctcgcagc ctgcgactcc        60
     gacgcgacct gccccgaggg gcaggtggag tgcgccggcc ggtgcgtcgc gctcgcgacc       120
     gacccgctga actgcggcgc gtgcggcgtg gcctgcgggc ccggcgccac ctgcggcgcg       180
     ggcgcgtgcg ggtgcggccc cgggacggtc ctctgcggcg cgacctgcgc gcagctggag       240
     agcgatcccg accactgcgg cgcctgcggg agcgcgtgcc gggacgcgca ggtgtgcagc       300
     tcggccggcg gcgcggccgc ctgcgccgac gcgtgcggcg aagggcaggt cgcctgcggc       360
     cgcgcctgcg tcgagctcgc gttcgaccgc taccactgcg gcgcgtgcgg gaccgtgtgc       420
     cagccggggg aggcgtgcga cgcagggacg tgccgctccc tgcaggtcgc gtgcttcgcc       480
     accgacgacg tgcggccgat cgcgccggac ctcgccgccg cgggctcgcc gcggccggcg       540
     ggcgacggcc cgatcgcgct cgcggccctg ggcggcgacg tatgggccgc ggcggcgctc       600
     tcggggagcg tgatccggct gccgctcgac ctctccgcgc cgcccgtcga gcacgcgctg       660
     cacggctcgg acctggaggg catcgccgcc gcgtccgacc gcttgctggt ctcgaactcg       720
     ggcggcggct cggtggcagt ggtcgatccc gtcaccgggc gcgtgctcga cgacgtgctc       780
     atccccgggc tcccgggcgc caacccgcgc ggcatcgcgg tgctggacgg caaggcctac       840
     gtggcgctgt acggccggga cgaggcgagc ggcgggcagg gggtggcggt gctcgatctg       900
     tcgcgcctcg ccgggtgcgc cgccgcgccc tgcgcgacgg tggagcgcgt ggtggacctg       960
     cgcggcgcgg ccgacgccgg cggcctgccg ttcccgggca aggccgtcgc cgccggcggg      1020
     cgcgcgtgga tcacgatcgc gaacctggcg cgcgacaccg acccggcgag ctggacctac      1080
     ggctactacg tgaagccggc cggcccggga cggctcgcgg cgctggacgg cacgtccgac      1140
     gccgtgcagc tggtctcgct cggcgacggg tgccggaacc cgggcgcgct ggcggtggac      1200
     ggcgccacgc tctgggtctc ctgcggcgcg gcgggcgcgg ccggcctcgt gccggtggac      1260
     gtgtccgatc cccgcgcgcc ggtggtcgga cccgtgctcg cgaccgcctt cgacgctccc      1320
     ggtgccgtgg ccatctgccg cggagcgggg ttcgtggccg accagtatac aggtcgggtg      1380
     cagcgcttcg acccggtgac caggacgagc gaggagacgg tgaccgcctg cccggtgggt      1440
     gcgcagggct gggcctgggc cgcggatctc ctgtgcgctc ccgcgcgctg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page