(data stored in ACNUC7421 zone)

EMBL: CP000251.PE338

CP000251.PE338       Location/Qualifiers
FT   CDS_pept        399749..400327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80116"
FT                   /db_xref="GOA:Q2IMT7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80116.1"
FT                   /translation="MTPPTPAARRTSGRPRAGARRAPLLVAAVVLGVATLVIADRTLGG
FT                   SGAPRTDAPAPPLRVGAVSGGGEIDLARLRGRAVVVNFWAPWCAPCQAELPDLAAVKQD
FT                   LAGRCVELVGIAGDGTRTEVAQVAARQPYPIGFDERGDAMRAWRVESVPTTYLVDADGK
FT                   VRTVIPGAVGREELLEALRPIIPATCPAG"
     atgacacctc caactcctgc ggcgcgccgc acctcgggtc gcccgcgcgc gggcgcgcgt        60
     cgcgcgccgc tcctcgtggc cgcggtggtg ctcggcgtgg cgacgctggt gatcgccgac       120
     cggacgctgg gcggctccgg ggcgccgcgc acggacgcac cagcgccgcc gttgcgggtc       180
     ggagccgtga gcggcggcgg agagatcgat ctcgcgcggc tacgcgggcg cgccgtggtg       240
     gtgaacttct gggcgccctg gtgcgcgccg tgccaggccg agctgccgga tctcgcggcg       300
     gtcaagcagg acctggcggg acgctgcgtc gagctcgtcg ggatcgcggg cgatggcacg       360
     cggaccgagg tggcgcaggt cgccgcgcgg cagccgtatc cgatcggctt cgacgagcgc       420
     ggggacgcga tgcgggcctg gcgcgtggag tcggtgccca cgacctacct cgtggacgcg       480
     gacgggaagg ttcgtacggt gatccccggc gccgtcggcc gcgaggagct gctcgaggcg       540
     cttcgcccga tcatcccggc gacgtgtccg gcggggtga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page