(data stored in ACNUC7421 zone)

EMBL: CP000251.PE339

CP000251.PE339       Location/Qualifiers
FT   CDS_pept        400512..401399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80117"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80117.1"
FT                   /translation="MKPHPWKPILALLAAITLATPAAAKEGGDQYPVGVDGLAAGALPP
FT                   PGTYLLSMVALVHGDVQDADGHDAGVEANAQFGVLRLVHVTKLRVLGAQYAFGAILPYW
FT                   HQSAKIRTPAGKLELDADGPGDITLNPVYLNWHLPRNLHLLATVDLNLPTGRFRTDGGL
FT                   SQGVGYYSVSPAVAATWYAPGGFEASGKLLYNLKRENPVTGVRSGDELELDFAVAKLFG
FT                   PFEAGIGGYYAVQTTDDELDGQKVNAKAEGLALGLQAAYQAPFGTFIGMWHHDVTSDSR
FT                   LQADRVFLKFMLPL"
     atgaaaccgc atccatggaa gcccatcctc gcgctcctcg cggcgatcac cctggcgacg        60
     cccgcggccg cgaaggaagg cggcgatcag tacccggtgg gcgtcgacgg cctcgccgcc       120
     ggcgcgctcc ctccgccggg cacctacctc ctgagcatgg tcgcgctcgt gcacggcgac       180
     gtccaggatg ccgacgggca cgacgcgggc gtcgaggcga acgcgcaatt cggcgtgctg       240
     cgcctggtcc acgtcaccaa gctccgagtg ctcggggcgc agtacgcgtt cggcgcgatc       300
     ctgccgtact ggcaccagag cgcgaagatc cgcacgccgg cgggcaagct ggagctggac       360
     gcggacggcc ccggcgacat cacgctgaac cccgtctacc tgaactggca cctcccgcgg       420
     aacctccacc tgctcgccac cgtggacctg aacctgccca cggggcgctt ccgcaccgac       480
     ggcggactga gccagggcgt cggctactac agcgtcagcc cggccgtcgc cgccacgtgg       540
     tacgcgcccg gcggcttcga ggcctcgggg aagctcctgt acaacctcaa gcgcgagaac       600
     cccgtcaccg gcgtccggtc cggcgacgag ctcgagctcg acttcgcggt ggcgaagctc       660
     ttcgggccgt tcgaggccgg catcggcggc tactacgcgg tgcagaccac cgacgacgag       720
     ctggatggcc agaaggtcaa cgcgaaggcc gagggcctcg ccctgggcct ccaggccgcg       780
     tatcaggcac cgttcggcac gttcatcggc atgtggcacc acgacgtgac gagcgacagc       840
     cgcctgcagg cggatcgcgt cttcctcaag ttcatgctcc cgctgtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page