(data stored in ACNUC7421 zone)

EMBL: CP000251.PE342

CP000251.PE342       Location/Qualifiers
FT   CDS_pept        complement(403933..404667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80120"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80120.1"
FT                   /translation="MSPGARKGAAGAAQREDVGEAEVVREYGPFDGAPVHGVSFDGERV
FT                   WAATGARLVAFDPASGEPVRTLEVACDAGTAFDGRHLYQLAGDRILRVDPTTGAVLGSI
FT                   PAPEGAGGSGLCWAEGSLWLGRYGERRILRLDPATGAVLRTIESDRFVTGVTWVDGELW
FT                   HGTMEAGESELRRVDPDGGAVRARLAMPRGVLVSGLESDGAGLFFCGGAASGKVRAVRR
FT                   PGPAGRTASRARRAGPRGPRRR"
     atgagccccg gagcgaggaa gggcgccgcg ggcgcggcgc agcgcgagga cgtcggcgag        60
     gcggaggtgg tgcgcgagta cggcccgttc gacggcgccc cggtgcacgg cgtcagcttc       120
     gacggcgagc gcgtctgggc ggcgaccggc gcgcggctcg tcgcgttcga cccggcgagc       180
     ggcgagccgg tccgcacgct ggaggtcgcg tgcgacgccg gcaccgcctt cgacggccgg       240
     cacctctacc agctcgcggg cgaccggatc ctgcgcgtgg accccaccac cggggcggtc       300
     ctcggcagca tccccgcgcc agagggcgcc ggcggctcgg gcctgtgctg ggccgagggg       360
     agcctgtggc tcgggcgcta cggggagcgc cggatcctcc ggctcgatcc ggccaccggc       420
     gccgtcctcc gcaccatcga gtcggatcgc ttcgtcaccg gggtcacctg ggtggacggc       480
     gagctgtggc acgggacgat ggaggcgggc gagagcgagc tgcgccgggt ggaccccgac       540
     ggcggcgcgg tgcgggcgcg cctcgccatg ccgcgcggcg tgctggtgag cgggctcgag       600
     tccgacggcg cggggctctt cttctgcggg ggcgccgcga gcgggaaggt gcgcgcggtg       660
     cgccgccccg ggcccgccgg acggacggcg agccgggcgc ggcgcgccgg cccgcgcggc       720
     ccgcgccggc gctag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page