(data stored in ACNUC7421 zone)

EMBL: CP000251.PE349

CP000251.PE349       Location/Qualifiers
FT   CDS_pept        complement(410420..411406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80127"
FT                   /db_xref="GOA:Q2IMU5"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80127.1"
FT                   /translation="MERPTSEPRTPPARSIASFLVPALGLACVALPHVSPALALTAGVA
FT                   LALSTGNPYAPTTRALARRLLPLSVVALGGAMDLRVVAHVGARGVGYTFVSIAACLALG
FT                   ALLARAARVEARTAALISVGTAICGGSAIAAVAPVVGADEHETSIALGAVFLLNSAALL
FT                   VFPLLGHAAGLGEPAFGLWAALGIHDTSSVVGATLAYGPQALAVGTTVKLARALWIVPV
FT                   TLAIGIVARRARGGGAATSARPPWFILGFVAVAALATFLPALRPAGLLAAEAGRRALVL
FT                   TLFLVGLGLSRQALRSVGAGALAMAVALWIAVGTATLAAVRTGLVHL"
     atggaacggc ccacctccga gccccgcacc ccgcccgcgc gatcgatcgc gtccttcctc        60
     gtgccggccc tgggcctggc ctgcgtcgcc ctcccgcacg tctccccggc gctcgcgctc       120
     accgccggcg tcgcgctcgc gctctcgacc gggaacccgt acgcccccac cacgcgcgcg       180
     ctggcccgcc ggctcctgcc gctgtcggtg gtggcgctcg ggggcgccat ggacctccgc       240
     gtcgtggcgc acgtcggggc gcgcggcgtg ggctacacct tcgtcagcat cgccgcgtgc       300
     ctggcgctgg gcgcgctcct cgcccgcgcc gcgcgggtgg aggcccgcac cgcggcgctc       360
     atctcggtcg gcacggccat ctgcggcggg agcgccatcg ccgcggtcgc gccggtggtc       420
     ggggcggacg agcacgagac ctcgatcgcg ctcggcgcgg tgttcctgct caactcggcc       480
     gcgctgctcg tgttcccgct gctcggccac gccgccggcc tcggcgagcc ggcgttcggc       540
     ctgtgggcgg cgctcggcat ccacgacacg agctcggtgg tgggcgcgac gctcgcctac       600
     ggcccgcagg cgctcgcggt cgggaccacc gtgaagctgg cccgcgcgct ctggatcgtg       660
     ccggtgacgc tcgccatcgg gatcgtggcg cggcgcgcgc gcggcggcgg ggcggcgacg       720
     tcggcgcgcc cgccctggtt catcctcggc ttcgtggcgg tggccgcgct cgcgacgttc       780
     ctgcccgcgc tgcgtcccgc cgggctgctc gccgccgagg cggggcgccg cgcgctggtg       840
     ctgacgctgt tcctggtggg cctcgggctc tcccgccagg cgctgcgctc ggtcggggcc       900
     ggcgccctcg ccatggcggt cgcgctctgg atcgcggtcg gcaccgcgac gctcgccgcg       960
     gtgcggaccg gcctcgtgca cctctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page