(data stored in ACNUC7421 zone)

EMBL: CP000251.PE351

CP000251.PE351       Location/Qualifiers
FT   CDS_pept        complement(412443..412865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80129"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80129.1"
FT                   /translation="MPGLRRRRGALPGAARQPRDHAGSGSIQCEREAVLTWIGVPDGRE
FT                   GVLDALLSRLPIQGFERRTQACTVEGLAATCRVLRNATGKPPTVVGAEQVVRGTRLVVT
FT                   CVSFREGTEVSEICRPVLSLSAPAPAAAEPAAPAAR"
     gtgccaggcc ttcgcaggcg ccgaggagcg ctgccgggtg ctgctcgcca gcctcgcgac        60
     catgcgggct ccggatcgat ccagtgcgag cgagaggcgg tgctcacgtg gatcggcgtc       120
     cccgacgggc gggagggcgt cctcgacgcg ctcctgtcca ggctcccgat ccagggcttc       180
     gagcgccgga cgcaggcgtg cacggtcgag gggctcgccg ccacctgccg cgtcctgcgg       240
     aacgcgacgg gcaagccgcc caccgtcgtc ggcgccgagc aggtcgtccg cgggacgcgc       300
     ctggtggtca cctgcgtgag cttccgcgag ggcaccgagg tgtccgagat ctgcaggccg       360
     gtgctctcgc tgtccgcgcc ggcgccagcc gccgccgagc cagccgcccc cgccgcgcgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page