(data stored in ACNUC7421 zone)

EMBL: CP000251.PE353

CP000251.PE353       Location/Qualifiers
FT   CDS_pept        414176..414895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80131"
FT                   /db_xref="InterPro:IPR025412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80131.1"
FT                   /translation="MRGCGRVHAPLHRQAAEAPRPRHRAGTRAAHHAPRRRATAKTPAQ
FT                   QLLDEVIRNGLAPMLKALGFRKAGRTFRSAAPRCVLVVNVQASHWSTRDALQFTVNVGA
FT                   FYIGLNDVLQRGTWPSPSTSGPTEYQCHVRQRLGRLTPAQRDVWWDLKVGAPWTQVSVE
FT                   VTEAVREHGLPWLRAMTDLDMARSHAEARSGPHIAAGLALLAGRRDEATRIVVVATESG
FT                   ADRGQLRLWARQADLIP"
     gtgagaggat gcgggcgtgt acacgctccg ctgcaccggc aagctgctga agcgcctcgg        60
     ccccgtcacc gagctggcac gcgagccgcc caccacgctc ctcggcgacg cgccacggca       120
     aagacgcctg cgcagcagtt gctcgacgag gtgatccgga acgggctcgc gccgatgctg       180
     aaggcgcttg gcttccggaa ggcgggccgc acgtttcgca gcgccgcgcc ccggtgcgtg       240
     ctcgtcgtga acgtgcaggc gagccactgg agcacccgcg acgcgctgca gttcaccgtc       300
     aacgtgggtg cgttctacat cggcttgaac gacgtcctgc agcgcggcac ctggccgagc       360
     cccagcacct cgggtcccac tgagtaccag tgccacgttc gccagcggct ggggcgcctc       420
     acgcccgcgc agcgcgacgt atggtgggac ctgaaggtcg gagcgccctg gactcaggtc       480
     tcggtggagg tcaccgaggc ggtgcgcgag cacgggttgc cgtggctccg agcgatgacg       540
     gatctcgaca tggcacggag ccatgccgaa gcgcgcagcg gtcctcacat cgccgcgggg       600
     ctcgccctgc tcgcggggcg tcgcgacgag gccacgcgca tcgtggtcgt ggcgacggag       660
     tcgggcgcag atcgaggcca gcttcgcctc tgggcgcggc aggccgacct gatcccctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page