(data stored in ACNUC7421 zone)

EMBL: CP000251.PE360

CP000251.PE360       Location/Qualifiers
FT   CDS_pept        complement(424130..424513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80138"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80138.1"
FT                   /translation="MDCPRCSVELNEIAHEDSAVQRCAECGGIWVGDAADLNKVLLHAN
FT                   LPALSALGGYVNADEISGMCPACNVDLVVVEGGEKRSLAYDTCESCGGIWVDGTEDEPA
FT                   AELDWKGATSQVVAFFKAFAKKK"
     atggattgcc cgcggtgcag cgtcgaattg aacgagatcg cccacgagga cagcgcagtc        60
     cagcgctgcg ccgagtgcgg aggcatctgg gtgggtgacg ccgccgatct caacaaggtg       120
     ctgctgcacg ccaacctgcc ggcgctgtcg gcgctcggcg ggtacgtgaa cgcggacgag       180
     atctcgggga tgtgcccggc ctgcaacgtg gacctggtcg tcgtcgaggg gggcgagaag       240
     cgctcgctcg cctacgacac ctgcgagtcc tgcggcggca tctgggtgga cgggaccgag       300
     gacgagccgg cggcggagct cgactggaag ggcgccacct cgcaggtcgt cgcgttcttc       360
     aaggcgttcg cgaagaagaa gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page