(data stored in ACNUC7421 zone)

EMBL: CP000251.PE363

CP000251.PE363       Location/Qualifiers
FT   CDS_pept        complement(426640..427500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0365"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80141"
FT                   /db_xref="GOA:Q2IMV9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80141.1"
FT                   /translation="MSEGEAWTTLRLLAWTQEFFGRKGVDAPRLTAELLLAHALRCERM
FT                   RLYLDFDKPLGAPELAAFRELVRRRGEGEPTAYLTGRRDFYGRPFRVDARVLVPRPETE
FT                   LVLEAARDALPEGGAALDLCTGSGALGVSLALERAGARVVATDLSADALVVAEENARAL
FT                   GAAVDLRQGDLWAALREGERFDVIVSNPPYVPRGELDTLPREVRREPRLALDGGPDGLD
FT                   LLRRIVEGAPARLVPGGTLVLEMHERHLDVLPRLCREAGFERAEARPDLAGLPRLTVAR
FT                   LAGAA"
     gtgagcgagg gcgaggcctg gacgacgctc cgcctcctcg cctggaccca ggagttcttc        60
     ggccgcaagg gcgtggacgc gccgcggctc accgcggagc tgctgctcgc gcacgcgctg       120
     cgctgcgagc ggatgcggct ctacctcgac ttcgacaagc cgctcggcgc gccggagctg       180
     gccgcgttcc gcgagctggt gcgccgccgg ggcgagggcg agcccaccgc ctacctcacc       240
     ggccggcgcg acttctacgg ccggccgttc cgggtggacg cgcgcgtgct ggtgccgcgg       300
     cccgagaccg agctcgtgct ggaagcggcg cgggacgcgc tgccggaggg cggggccgcg       360
     ctcgacctgt gcaccgggtc cggcgccctg ggcgtgtcgc tcgcgctgga gcgggccggc       420
     gcgcgggtgg tcgcgaccga cctctccgcc gacgcgctcg tggtcgccga ggagaacgcg       480
     cgcgcgctcg gcgcggcggt ggacctgcgc cagggcgacc tgtgggcggc gctccgcgag       540
     ggcgagcgct tcgacgtgat cgtgtccaat ccgccctacg tcccgcgtgg cgagctggac       600
     acgctcccgc gggaggtgcg ccgcgagccg cggctggcgc tcgacggcgg ccccgacggc       660
     ctcgacctgc tccggcgcat cgtggagggc gcgccggccc ggctcgtgcc cggcggcacg       720
     ctcgtgctgg agatgcacga gcgccacctg gacgtcctgc cgcggctctg ccgggaggcg       780
     gggttcgagc gggcggaggc gcggccggac ctggccggcc tgcccaggct cacggtggcg       840
     cgcctggcgg gcgccgcgta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page