(data stored in ACNUC7421 zone)

EMBL: CP000251.PE369

CP000251.PE369       Location/Qualifiers
FT   CDS_pept        complement(432995..434875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80147"
FT                   /db_xref="GOA:Q2IMW4"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80147.1"
FT                   /translation="MPKKIRAAAVSFLNAWPLTAGLEGSERIELVQAEPSRCAAMLEAG
FT                   EVDLALVSVAALTKGQYDIVPGIAIGADGPVQTVVLAGEQSPAIWDEVFLDTASRTSHV
FT                   LAKLVLDAKGVHPRFTPMPAEEGLARAKGTKGALVIGDRGFGVRANHVLDLGREWTQLT
FT                   GLPMIFALWAARPGAVSPEDVQELTRAAQHGLGIRTELAQKFAALKGGDPEKYRRYLTQ
FT                   KIRYGLGPYELQGLEAFLERAATKGFLPPMPLRFVDDVVRTRRVRRAVSVDTALQKGAD
FT                   GERLDADEAATLDEHAPLLELGLAADARRRALHPGDLVTYIVSRNVNYTNVCTTACHFC
FT                   AFYRPRGHQESYVLTREELTQKIDETVALGGIEILLQGGLHPDLGVEWYEDLFRWVKQT
FT                   WPVINLHALSPEEIWHIARTSELGLEATIDRLIAAGMDSIPGGGAEILDDEVRRRIAPL
FT                   KCSTDEWLTVMKAAHRKGLKSTATMMFGVGEGPEHRVAHLMRLRELQDETHGFTAFICW
FT                   PFQSQNTRLEPGDGSAHAYLRTNALSRLVLDNVPNLQASWVTMGGGVAQAALHMGCNDF
FT                   GQVMIEENVVSAAGTTFKMDSEEVERHIRDAGFRAARRNMKYQLVEETRA"
     atgccgaaga agatccgcgc cgccgccgtc tcgttcctga acgcctggcc gctcaccgcc        60
     gggctggagg gctccgagcg catcgagctg gtgcaggccg agccgtcccg ctgcgcggcc       120
     atgctggagg cgggcgaggt ggacctggcg ctcgtgtcgg tcgccgcgct caccaagggg       180
     cagtacgaca tcgtgccggg catcgccatc ggcgccgacg ggccggtgca gacggtggtg       240
     ctcgccggcg agcagtcgcc ggccatctgg gacgaggtgt tcctcgacac cgcctcccgc       300
     acctcgcacg tgctcgcgaa gctcgtgctc gacgcgaagg gcgtccaccc gaggttcacg       360
     cccatgcccg cggaggaggg gctcgcccgc gccaagggca ccaagggcgc gctcgtgatc       420
     ggcgaccgcg ggttcggcgt ccgcgcgaac cacgtgctcg acctgggccg cgagtggacg       480
     cagctcaccg ggctgcccat gatcttcgcg ctgtgggcgg cgcggccggg cgcggtctcg       540
     cccgaggacg tgcaggagct gacccgggcc gcgcagcacg ggctcgggat ccgcaccgag       600
     ctggcgcaga agttcgccgc gctgaagggc ggggacccgg agaagtaccg ccggtacctc       660
     acccagaaga tccgctacgg cctcggcccc tacgagctgc aggggctgga ggcgttcctg       720
     gagcgcgccg ccacgaaggg cttcctgccc cccatgccgc tccgcttcgt ggacgacgtg       780
     gtccggaccc ggcgcgtgcg ccgcgccgtc tcggtggaca ccgcgctgca gaagggcgcg       840
     gacggcgagc ggctcgacgc cgacgaggcg gccacgctcg acgagcacgc gccgctgctc       900
     gagctcgggc tcgccgccga cgcgcgccgg cgcgcgctcc accccggcga cctcgtcacc       960
     tacatcgtgt cgcggaacgt gaactacacg aacgtgtgca ccaccgcgtg ccacttctgc      1020
     gcgttctacc gcccccgcgg ccaccaggag tcctacgtcc tcacccgcga ggagctgacg      1080
     cagaagatcg acgagacggt ggcgctcggc ggcatcgaga tcctgctgca gggcggcctc      1140
     caccccgacc tcggcgtcga gtggtacgag gacctgttcc gctgggtgaa gcagacctgg      1200
     ccggtgatca acctgcacgc gctctccccc gaggagatct ggcacatcgc ccggaccagc      1260
     gagctcgggc tcgaggccac catcgaccgg ctgatcgcgg ccgggatgga ctccatcccg      1320
     ggcggcggcg ccgagatcct ggacgacgag gtccgccgcc ggatcgcgcc gctcaagtgc      1380
     tccaccgacg agtggctcac ggtgatgaag gccgcgcacc gcaaggggct gaagagcacc      1440
     gccaccatga tgttcggggt gggcgagggg ccggagcacc gggtggcgca cctgatgcgg      1500
     ctgcgcgagc tgcaggacga gacgcacggc ttcacggcgt tcatctgctg gccgttccag      1560
     tcgcagaaca cccggctcga gccgggcgac gggagcgccc acgcctacct gcgcacgaac      1620
     gcgctctcgc gcctggtgct cgacaacgtc cccaacctgc aggcgtcgtg ggtgaccatg      1680
     ggcgggggcg tcgcgcaggc cgcgctgcac atgggctgca acgacttcgg ccaggtgatg      1740
     atcgaggaga acgtggtctc cgcggccggc accaccttca agatggactc ggaggaggtg      1800
     gagcggcaca tccgcgacgc cggcttccgc gccgcccgcc gcaacatgaa gtaccagctg      1860
     gtggaggaga cccgcgcgtg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page