(data stored in ACNUC7421 zone)

EMBL: CP000251.PE37

CP000251.PE37        Location/Qualifiers
FT   CDS_pept        complement(47456..47899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0037"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79815"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79815.1"
FT                   /translation="MKIRQLSLFLENRPGQLRVPCQVLGDAGIDILTLSLADTQQFGIL
FT                   RLIVKDHTRARQVLEQAGVVVNVTDVLAVDVPDRPGGLAEVLQGFEACGLGIEYMYAYS
FT                   VRSRGEHATLVFRLSDPDRAAALLQARGVRLVGAAELFARAGA"
     atgaagatcc gtcagctctc gctcttcctc gagaaccgcc ccgggcagct ccgggtcccg        60
     tgccaggtgc tgggcgacgc gggcatcgac atcctcaccc tgtcgctcgc cgacacgcag       120
     cagttcggga tcctgcgcct catcgtgaag gaccacacgc gcgccaggca ggtgctcgag       180
     caggccggcg tggtggtgaa cgtcaccgac gtgctggcgg tggacgtccc cgaccggccg       240
     ggcggcctcg ccgaggtgct gcagggcttc gaggcctgcg gcctgggcat cgagtacatg       300
     tacgcgtact cggtgcggag ccgcggcgag cacgccacgc tcgtcttccg cctctcggat       360
     ccggaccggg ccgccgcgct cctgcaggcg cgcggcgtcc gcctggtggg cgcggccgag       420
     ctgttcgcgc gcgcgggggc ctag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page