(data stored in ACNUC7421 zone)

EMBL: CP000251.PE370

CP000251.PE370       Location/Qualifiers
FT   CDS_pept        complement(434890..436056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80148"
FT                   /db_xref="GOA:Q2IMX0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80148.1"
FT                   /translation="MLSILANRALERDGLGPIRDKVLAGERLGDADGLRLFEAADLPAL
FT                   GALANHVREARHGALAFYNRNVHLNPTNVCVASCKFCSFARKDDQRASDGYTMSLDEAV
FT                   AKVLSRKPLGVTEVHIVSGLHPDLPFEYYTELLSRIRAAWPEVAIKAFTAIEIHFFAEK
FT                   FGMSYEQVLRRLMDAGLQTMPGGGAEIFAPRVRRKICDDKATADQWIEIHRTAHRLGVK
FT                   TNSTMLYGHIERLDERVDHMRRLRALQDETHGFQVFIPLAFHPEHNMIGKAFPKPTGYD
FT                   ALRTLAVARLYLDNFDHVKAYWVSLGERLAQTALSFGVDDLDGTVLEERIYHMAGSTVP
FT                   QALSERTLHQLIRAAGRVPAERDSLYRVLKVHDAPLPAEPPARLQVTA"
     atgctctcga tcctggcgaa ccgcgcgctc gagcgcgacg gcctcgggcc catccgcgac        60
     aaggtgctgg ccggcgagcg gctcggcgac gccgacggcc tgaggctgtt cgaggccgcc       120
     gacctgcccg cgctcggcgc gctcgcgaac cacgtgcgcg aggcccgcca cggcgcgctc       180
     gcgttctaca accgcaacgt ccacctcaac ccgaccaacg tctgcgtcgc gtcctgcaag       240
     ttctgctcgt tcgcgcgcaa ggacgaccag cgcgcctccg acggctacac catgtcgctc       300
     gacgaggcgg tggcgaaggt gctgtcgcgc aagccgctcg gcgtcaccga ggtgcacatc       360
     gtctccggcc tgcaccccga cctgccgttc gagtactaca ccgagctgct ctcgcggatc       420
     cgggccgcct ggcccgaggt ggccatcaag gcgttcaccg ccatcgagat ccacttcttc       480
     gccgagaagt tcggcatgag ctacgagcag gtgctgcgcc ggctgatgga cgccgggctg       540
     cagaccatgc ccggcggcgg cgccgagatc ttcgcgccgc gggtgcgccg gaagatctgc       600
     gacgacaagg ccaccgccga ccagtggatc gagatccacc ggaccgccca tcgcctcggc       660
     gtgaagacca actccaccat gctctacggc cacatcgagc ggctggacga gcgggtggac       720
     cacatgcgcc ggctgcgcgc gctgcaggac gagacccacg ggttccaggt cttcatcccg       780
     ctcgcgttcc accccgagca caacatgatc ggcaaggcgt tcccgaagcc caccggctac       840
     gacgcgctgc gcacgctcgc ggtggcgcgc ctgtacctcg acaacttcga ccacgtgaag       900
     gcgtactggg tgtcgctcgg cgagcggctg gcgcagaccg cgctgtcgtt cggcgtggac       960
     gacctcgacg gcaccgtgct cgaggagcgc atctaccaca tggccgggtc caccgtgccg      1020
     caggcgctca gcgagcgcac gctgcaccag ctcatccgcg ccgccggccg cgtgccggcc      1080
     gagcgcgaca gcctctaccg cgtgctgaag gtccacgacg cgccgctccc cgccgagccg      1140
     cccgcccgcc tccaggtcac cgcctga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page