(data stored in ACNUC7421 zone)

EMBL: CP000251.PE374

CP000251.PE374       Location/Qualifiers
FT   CDS_pept        439013..439288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80152.1"
FT                   /translation="MERRNRARDLIVLALAELDGELSTNQHRLCPEQLGTCRSRLQGYL
FT                   SALDGDALPPKRERAEDLGRLILDSWPYDVPLGQVILRAERAWRNA"
     atggaacgcc gaaaccgcgc ccgcgacctc atcgtgctcg cccttgcaga gctcgacggc        60
     gagctgtcca ccaaccagca ccggctctgc cccgagcagc tcggcacgtg ccgctcgcgc       120
     ctgcagggct acctctcggc gctcgacggc gacgcgctgc cgcccaagcg cgagcgggcg       180
     gaggacctgg gccggttgat cctcgactcc tggccctacg acgtgccgct cgggcaggtg       240
     atcctgcgcg ccgagcgggc ctggcgaaac gcctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page