(data stored in ACNUC7421 zone)

EMBL: CP000251.PE375

CP000251.PE375       Location/Qualifiers
FT   CDS_pept        complement(439352..442216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0377"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80153"
FT                   /db_xref="GOA:Q2IMX5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80153.1"
FT                   /translation="MPSFALKSPVAVARAAIAPTLRPAPPGDCASRPPVHTCHSMRARF
FT                   AALAPLLLASCAFGRPRLSTPACATGAEALPSGIQLVAYALPHRPDTLVAASYRVGSAR
FT                   DPAGKEGLAHLVEHLSFRARHGGGRALSARLEAEGVEFDGRTSADATDFHAVGDPDQLD
FT                   ALLRIEADRLRDPLAGVDEAELRREREVVLQELALRGDPDALGSQVDWLTARALAGHPY
FT                   GRIATPESLRAITLEDVRAFARAHYRPENLLLLVAGPAPAGAVAARARAALGELATRPG
FT                   EPADPPVAPPELRASRPAALDVVRAPVERAWLLLTVPLPGDAAAGGARAYLALRALEAQ
FT                   VEQVLSGPDRDRALSVELLVHGMDGASLPVIRIGLRDPDDARPLVERLRAGLRFAGWQG
FT                   GPDPGAEELRDRLVLDAHVRLEAFDASEVARWIRLTGRTDYLTGMPAAVGAAVTPDRAA
FT                   FARRWLREERLVALAVVPGEAPRDEAPPRLAGASALDDDDPHGAAAAGEPAPARDAARA
FT                   MRPPHLDSARRRRLKNGVRVIVSPRPGYRVLSAHLVVRTAPAGPLERVFEVLALRAARC
FT                   ADRPATVGGDRLEFGARAPTELVDLALAQVACRAGDLAVDAAAFERERDAMADALRRRP
FT                   PTLHETAGQQLLELLYPGHPYSAEVTEARVRAFRAADAGKWLGLNVRPERAALVIAGDV
FT                   EATDALFERIEQRLGRWRPRGGDGTLPARPPAPLPGRRELVVVDRPGWRVAEVLVGVRV
FT                   PPRGARDEAAFRTLSWRLQHVLTARLREGEGLTYRVSLSMLEQSLGSALVLSTAVDRAR
FT                   AGEALAAVLAELAASARPLDPEALARARWRAVRRAGRALGTSWRNALRLTEMFVHGLPP
FT                   DEWDTFAARAAALDARALVAEAGRWALGREAIVVVGDAAVIAPALEAAGLPARVLPAIA
FT                   RRPPAETAAVGSAAAEPGPRASAP"
     ttgccttcgt tcgccctgaa gtcgccggtt gccgtggcgc gggcggcgat cgcaccgacg        60
     ctccgtcctg caccacccgg ggactgcgct tcgcgccccc cggtccatac ctgccattcg       120
     atgcgcgccc gcttcgccgc gctcgccccg ctcctgctcg cgtcctgcgc cttcggcagg       180
     ccccggctct ccacgcccgc ctgcgccacc ggggcggagg cgctgccctc cgggatccag       240
     ctggtcgcgt acgccctgcc ccatcgtccg gacacgctgg tggccgcgtc gtaccgggtc       300
     ggcagcgcgc gcgaccccgc cgggaaggag ggcctcgcgc acctcgtcga gcacctctcc       360
     ttccgcgcgc gccacggcgg cgggcgcgcc ctctcggcgc ggctcgaggc ggagggggtc       420
     gagttcgacg ggcgcacctc cgcggacgcc accgacttcc acgcggtggg cgatcccgac       480
     cagctcgacg cgctgctccg catcgaggcc gatcggctgc gggacccgct cgcgggggtg       540
     gacgaggcgg agctgcgccg ggagcgcgag gtggtcctgc aggagctggc gctgcggggc       600
     gacccggacg cgctcgggtc gcaggtggac tggctgaccg cccgcgcgct cgcgggccac       660
     ccctacgggc ggatcgcgac gcccgagtcg ctgcgcgcca tcacgctcga ggacgtgcgg       720
     gcgttcgcgc gggcgcacta ccgcccggag aacctgctgc tgctcgtggc ggggcccgcg       780
     ccggcggggg cggtcgccgc ccgcgcccgc gccgcgctcg gcgagctggc cacgcgcccg       840
     ggggagcccg ccgatccccc cgtcgcgccg cccgagctcc gcgcctcgcg gcccgcggcg       900
     ctcgacgtgg tgcgcgcgcc ggtggagcgc gcctggctcc tgctcaccgt gccgctcccg       960
     ggcgacgcgg ccgccggcgg cgcgcgggcg tacctggcgc tccgcgcgct cgaggcgcag      1020
     gtggagcagg tgctctccgg gccggaccgc gaccgcgcgc tctcggtgga gctcctcgtg      1080
     cacgggatgg acggcgcgtc gctgccggtg atccggatcg gcctgcgcga cccggacgac      1140
     gcgcggccgc tggtcgagcg gctccgcgcc ggcctgcgct tcgccggctg gcagggcggc      1200
     ccggatccgg gcgccgagga gctgcgggac cgcctggtgc tggacgcgca cgtgcggctc      1260
     gaggcgttcg acgcgtcgga ggtcgcccgc tggatccggc tcaccggccg caccgactac      1320
     ctcaccggca tgcccgcggc ggtcggcgcc gcggtgaccc cggaccgcgc cgcgttcgcc      1380
     cgccgctggc tgcgcgagga gcgcctggtg gcgctggcgg tcgtgccggg cgaggcgccg      1440
     cgggacgagg cgccgccgcg cctggccggc gcgagcgcgc tcgacgacga cgacccgcac      1500
     ggcgccgcgg ccgccggcga gcccgccccc gcgcgcgacg cggcccgcgc catgcgcccg      1560
     ccgcacctcg acagcgcgcg ccggcgccgg ctgaagaacg gcgtgcgcgt gatcgtgtcg      1620
     ccgcggcccg gctaccgcgt gctctcggcg cacctggtgg tgcgcaccgc gcccgccggc      1680
     ccgctggagc gcgtcttcga ggtgctggcg ctccgcgccg cccgctgcgc cgaccggccc      1740
     gccaccgtgg gcggcgaccg gctggagttc ggcgcgcgcg cgcccaccga gctcgtggac      1800
     ctggcgctcg cgcaggtggc ctgccgcgcc ggcgacctcg ccgtggacgc ggccgcgttc      1860
     gagcgcgagc gcgacgcgat ggcggacgcg ctgcgccgcc gcccgcccac gctgcacgag      1920
     accgccgggc agcagctgct cgagctgctc taccccgggc acccctactc ggccgaggtc      1980
     accgaggcgc gggtgcgcgc gttccgcgcc gcggacgcgg ggaagtggct cgggctgaac      2040
     gtgcggccgg agcgggccgc cctcgtcatc gccggcgacg tcgaggcgac cgacgcgctg      2100
     ttcgagcgca tcgagcagcg gctcgggcgg tggcggccgc gcggcggcga cggcaccctg      2160
     ccggcgcgtc cgccggcgcc gctgcccggc cggcgcgagc tggtggtggt ggaccgcccc      2220
     ggctggcggg tggccgaggt gctggtgggc gtgcgcgtcc cgccccgcgg cgcgcgcgac      2280
     gaggccgcgt tccggacgct gtcctggcgg ctccagcacg tgctcaccgc ccggctccgc      2340
     gagggcgagg ggctcaccta ccgggtgtcg ctctcgatgc tggagcagtc gctgggcagc      2400
     gcgctcgtgc tctccaccgc ggtggaccgc gcccgcgccg gcgaggcgct cgcggccgtc      2460
     ctggccgagc tcgccgcctc ggcccggccg ctcgacccgg aggcgctggc ccgggcccgc      2520
     tggcgcgcgg tgcgccgcgc cggccgcgcc ctcggcacct cctggcggaa cgcgctgcgc      2580
     ctcaccgaga tgttcgtgca cggcctgccg ccggacgagt gggacacgtt cgcggcgcgc      2640
     gctgcggcgc tcgacgcccg cgcgctcgtg gccgaggccg ggcgctgggc gctcggccgc      2700
     gaggcgatcg tggtggtggg cgacgccgcc gtgatcgcgc cggcgctgga ggccgcaggc      2760
     ctcccggcgc gggtgctgcc ggcgatcgcg cggcggccgc cggcggagac cgccgcggtc      2820
     gggagcgcgg ccgcggagcc cgggccgcgc gcttcggcgc cctga                      2865
//

If you have problems or comments...

PBIL Back to PBIL home page