(data stored in ACNUC7421 zone)

EMBL: CP000251.PE378

CP000251.PE378       Location/Qualifiers
FT   CDS_pept        complement(444986..446059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80156"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80156.1"
FT                   /translation="MAAAERFEAALPGGAFAPDPVPDDGPFSDGGAFFASRNVTPPAAF
FT                   RASTPAGAGGWLTVESYTRRAGASTRDLAEVVPDPADPANHALRITSRAHTDATVLRPS
FT                   APLPARYRISVRVGFPSFGDGVAGGLNGYDGPADAGPWWPGEDATRQNGFYWLTILDRL
FT                   PRPHVNTWIHHHRKVVVDSDNHYPPWMEIWDGGRFVWSGEHPVMLFALDGTQPGAERTG
FT                   PPFLSYSDGAWQPSGAIRAVDAYLPDTWYRVTIERDGPRYTVEVSGRFRYGGEQTYRAT
FT                   IDAAAACVFHYPVDAAEAAGAARCVDEGAFASVGPAYPRWPAGGVWPDWFMLGDPHVNY
FT                   YEGSVLYDDLVLETWRD"
     gtggcggccg cggagcgctt cgaggcggcg ctgcccggcg gcgcgttcgc gccggacccg        60
     gtgccggacg acggcccgtt ctccgacggc ggggcgttct tcgcttcacg gaacgtcaca       120
     ccgccggcgg cgttccgcgc ctcgacgccc gccggcgcgg gcggctggct caccgtggag       180
     tcgtacacgc gccgggcggg cgcctcgacg cgcgacctcg ccgaggtggt cccggatccc       240
     gccgaccccg cgaaccacgc cctgcggatc acctcgcgcg cgcacaccga cgcgaccgtg       300
     ctccggccct ccgcgccgct cccggcgcgc taccgcatct cggtgcgggt ggggttcccg       360
     tcgttcggcg acggggtcgc gggcgggctg aacggctacg acgggcccgc cgacgcgggg       420
     ccctggtggc cgggcgagga cgcgacgcgg cagaacggct tctactggct gaccatcctc       480
     gaccggctgc cgcggccgca cgtgaacacc tggatccacc accaccgcaa ggtcgtggtg       540
     gactccgaca accactaccc gccgtggatg gagatctggg acgggggccg cttcgtctgg       600
     tcgggcgagc accccgtcat gctgttcgcg ctcgacggca cgcagcccgg cgccgagcgc       660
     accggcccgc cgttcctgtc ctactcggac ggcgcctggc agccgtccgg cgcgatccgc       720
     gcggtggacg cctacctgcc ggacacctgg taccgcgtga cgatcgagcg cgacgggccg       780
     cgctacaccg tcgaggtctc ggggcggttc cgctacggcg gcgagcagac gtaccgcgcg       840
     acgatcgacg ccgccgcggc gtgcgtcttc cactacccgg tggacgcggc cgaggcggcg       900
     ggcgcggccc gctgcgtgga cgagggcgcg ttcgcgtcgg tggggccggc gtacccgcgc       960
     tggccggcgg gcggcgtctg gccggactgg ttcatgctcg gcgatccgca cgtgaactac      1020
     tacgagggca gcgtgctcta cgacgacctc gtcctggaga cgtggcgaga ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page