(data stored in ACNUC7421 zone)

EMBL: CP000251.PE382

CP000251.PE382       Location/Qualifiers
FT   CDS_pept        complement(448867..449700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80160"
FT                   /db_xref="GOA:Q2IMX8"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80160.1"
FT                   /translation="MRPLGHAALAALVALAAACGGRAARTPPLAIDPPAFRPEALLPTG
FT                   ADAYGVALALSGRIENPNPVALPVAGFTYAFEVMGAPAGGGQVASELVLPAGGAVPVTV
FT                   PVRLRWADVPGFLEALATRPSLPVTVSGAARVRAGGGTVAVPYRMDGSVVLPRLPSVTL
FT                   ADAVVRESTLFHTVVELRVSVRNPNPFPLPTGRLSYDLSVSGVPVIQAAKSALDAVPPQ
FT                   GQATVVVPVRFSTVGAAAGALAGAVRGRADLSVSGRAGYGALEVGVDLRGALAAR"
     atgcgtccgc tcggtcacgc agccctcgcc gccctcgtcg ccctcgccgc cgcctgcggc        60
     ggccgcgcgg cgcggacccc gccgctcgcg atcgatccgc cggcgttccg ccccgaggcg       120
     ctcctcccca ccggcgccga cgcgtacggc gtggcgctgg cgctctccgg ccggatcgag       180
     aacccgaacc cggtggcgct gccggtggcg ggcttcacct acgcgttcga ggtgatgggc       240
     gcgcccgccg gcggcgggca ggtggcgagc gagctcgtgc tcccggccgg cggcgcggtg       300
     ccggtgacgg tccccgtccg gctgcgctgg gccgacgtcc ccggcttcct ggaggcgctc       360
     gcgacgcgcc cctcgctgcc ggtgacggtg agcggcgccg cgcgggtgcg ggcgggcggc       420
     ggcaccgtgg cggtgccgta ccggatggac ggcagcgtgg tgctcccgcg cctgccctcg       480
     gtgacgctcg ccgacgcggt ggtgcgcgag tccaccctgt tccacaccgt ggtcgagctg       540
     cgcgtgagcg tgcggaaccc gaacccgttc ccgctgccca ccggccgcct ctcctacgac       600
     ctcagcgtct cgggggtgcc ggtgatccag gcggcgaagt ccgcgctcga cgcggtgccg       660
     ccgcagggcc aggcgacggt ggtggtgccg gtccgcttct ccacggtggg cgcggccgcg       720
     ggcgcgctgg ccggcgcggt gcgcggccgg gcggatctgt cggtgtcggg gcgcgccggc       780
     tacggcgcgc tggaggtggg cgtggacctg cgcggcgcgc tcgcggcgcg gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page