(data stored in ACNUC7421 zone)

EMBL: CP000251.PE390

CP000251.PE390       Location/Qualifiers
FT   CDS_pept        459652..459954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80168"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80168.1"
FT                   /translation="MRNVLFAAAAAALVAGCAMPQTVVKSVESRPSLAVVGAPAGAVLV
FT                   VDGQPVGEASAYDGNPAVLRVEPGTHQVEIRDPSGAAVYRQTVFVESELKTVRVH"
     atgcggaacg tgctcttcgc ggcggcggcc gccgcgctgg tggcgggctg cgccatgccg        60
     cagaccgtcg tgaagtccgt cgagagccgc cccagcctgg cggtggtggg cgcgccggcc       120
     ggcgcggtgc tcgtcgtgga cgggcagccc gtcggcgagg cgagcgcgta cgacgggaac       180
     cccgccgtgc tgcgcgtcga gccgggcacg caccaggtcg agatccgcga cccgtccggc       240
     gccgcggtgt accggcagac cgtgttcgtg gagagcgagc tgaagacggt gagggtgcac       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page