(data stored in ACNUC7421 zone)

EMBL: CP000251.PE393

CP000251.PE393       Location/Qualifiers
FT   CDS_pept        461204..461932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0395"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80171"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80171.1"
FT                   /translation="MSKLLLFYLLVQLTGSPLGALALLLAVWWLTDRMTVGVLPDPLRT
FT                   VARWRRRLQLARALEVNPHDRRARLELADLLLAGRRPARAAAVLRPNVEAGDEDAHTAF
FT                   LMGAALGRSGQADPAERALAVARAADPDFRAGEIDLELGRQRLGRGDAAGAREALERLL
FT                   VERPGSVEGRLWLARALDRLGDRDGARRRREEGWREYVSLPRFHRKHERPFAWRLQPWR
FT                   PTAVALGVVLVLAAVAAVAG"
     atgtccaagc tcctcctgtt ctacctgctc gtccagctca ccggcagccc gctcggcgcc        60
     ctggcgctgc tgctcgcggt ctggtggctc accgaccgga tgacggtcgg cgtcctgccg       120
     gacccgctcc ggaccgtcgc gcgctggcgc cgccggctcc agctcgcccg cgccctcgag       180
     gtgaacccgc acgaccgccg cgcgcggctc gagctcgcgg atctcctgct cgcggggcgc       240
     cgcccggccc gcgccgccgc ggtcctccgg cccaacgtcg aggccgggga cgaggacgcg       300
     cacaccgcgt tcctgatggg cgcggcgctc gggcggagcg ggcaggccga tccggcggag       360
     cgcgcgctcg ccgtcgcccg cgcggcggat cccgacttcc gcgccggcga gatcgacctc       420
     gagctcgggc gccagcggct cggccgcggc gacgccgccg gcgcgcgcga ggcgctggag       480
     cggctcctgg tggagcgccc cggatcggtg gaggggcgcc tctggctggc gcgcgcgctc       540
     gaccggctcg gcgaccgcga cggcgcccgc cgccggcgcg aggagggctg gcgcgagtac       600
     gtctcgctgc cgcgcttcca ccgcaagcac gagcgcccgt tcgcgtggcg gctgcagccc       660
     tggcggccga ccgccgtggc gctcggcgtg gtgctggtgc tcgccgcggt cgcggccgtg       720
     gccggttga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page