(data stored in ACNUC7421 zone)

EMBL: CP000251.PE397

CP000251.PE397       Location/Qualifiers
FT   CDS_pept        466201..466998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0399"
FT                   /product="ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80175"
FT                   /db_xref="GOA:Q2IMZ2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80175.1"
FT                   /translation="MPRTLRAIPTLLKVGFAEAVAYRAEMVVWLLSTNMPLVMLALWTA
FT                   VARDAPVGRFGQRDFVAYYLATLVVRLLTGAWVIWELNYEIRQGTLAFRLLRPVHPLLA
FT                   YAAENLSALPVRMLVSLPIALGALLVVGRDRLTGDPLLLALFPVTVLGAWLITFLAMAI
FT                   IGALAFWIDQAGSLFEIWLGLFGVFSGYLVPLELFPHWVATAARFLPFRYMLAFPVEMI
FT                   IGMTPRPVALAELAVQWTFVVALALGARGAWALGLRRFAAFGG"
     gtgccccgga ccctgcgcgc catccccacg ctcctcaagg tcggcttcgc cgaggcggtc        60
     gcgtaccgcg cggagatggt ggtgtggctg ctctccacca acatgccgct cgtcatgctg       120
     gcgctgtgga ccgcggtggc ccgcgacgcg ccggtggggc ggttcggcca gcgcgacttc       180
     gtcgcctact acctcgccac gctggtggtg cggctgctca ccggcgcctg ggtgatctgg       240
     gagctgaact acgagatccg ccagggcacg ctcgcgttcc ggctgctccg gccggtccac       300
     ccgctgctcg cctacgcggc ggagaacctg tccgcgctcc cggtgcgcat gctggtgtcg       360
     ctgcccatcg cgctcggcgc gctgctggtg gtcggccgcg accggctcac gggcgacccg       420
     ctgctcctcg cgctcttccc ggtcacggtg ctgggcgcct ggctcatcac cttcctcgcg       480
     atggcgatca tcggcgccct ggcgttctgg atcgaccagg ccggctcgct gttcgagatc       540
     tggctgggcc tgttcggcgt gttctccggg tacctcgtgc cgctcgagct gttcccgcac       600
     tgggtggcga ccgcggcgcg gttcctgccg ttccggtaca tgctggcgtt cccggtggag       660
     atgatcatcg ggatgacccc gcgcccggtc gcgctcgccg agctcgccgt ccagtggacg       720
     ttcgtggtcg cgctggcgct gggcgcgcgg ggcgcctggg cgctcgggct gcgccgcttc       780
     gcggcgttcg gagggtag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page