(data stored in ACNUC7421 zone)

EMBL: CP000251.PE40

CP000251.PE40        Location/Qualifiers
FT   CDS_pept        complement(49738..51378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0040"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79818"
FT                   /db_xref="GOA:Q2ILY7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79818.1"
FT                   /translation="MERRLLSGDEAVAAAARDAGVRLGTGYPGTPSTEILQALDALGGR
FT                   AQWAPNEKVALEVGLGAAFGGARALVTMKHVGLNVAADPLFTAAYTGVKGGLVVVSADD
FT                   PGMASSQNEQDNRHYAVAAGLPMLEPADSQEAYDLTVAAFELSERFAIPVILRMTTRVC
FT                   HSKTLAARRADLPAPPAPAFVRDIPGRVMIPAYARPAHRRLRKKLEALQAFAEETPLNV
FT                   WVKGDRALGVITSGVTARHVAEAAPSASRLELKTVYPLPLEKIRAFAASVDRCVVVEEG
FT                   DPVFADAIRAAGIAVESKEAPYRFGELDVQRVRRILARDPSPEPELPKGRPPALCEACP
FT                   YHPVYATLRKLDCIVAGDIGCYTLGVLPPYQGIDTCVAMGASLGVGLGLRHVLPEADAR
FT                   RVVSIIGDSTFIHTGLNGLVEMVYNPPPTGHVLVVLDNGTTAMTGQQEHPGTGRTLDHE
FT                   PTGKVSIEGLARALGVANVDVIDPVADPAGWEELLKERLAEPKLSVIIARRPCILAAAD
FT                   IRRYEKAADEKRAALACAGCAGAGEVSDA"
     atggaacggc ggcttctatc cggcgacgag gcggtggcgg cggcggcccg cgacgcgggc        60
     gtccggctcg gcaccggcta tcccggcacc ccctcgaccg agatcctcca ggcgctcgac       120
     gcgctcggcg gccgcgccca gtgggcgccg aacgagaagg tggcgctcga ggtgggcctc       180
     ggggccgcgt tcggcggcgc gcgcgcgctc gtgaccatga agcacgtcgg gctgaacgtg       240
     gccgccgacc cgctgttcac cgccgcgtac accggcgtga agggcgggct ggtggtggtg       300
     agcgccgacg atccgggcat ggcctcctcg cagaacgagc aggacaaccg gcactacgcc       360
     gtcgcggccg ggctgcccat gctcgagccc gccgactcgc aggaggcgta cgacctcacc       420
     gtggccgcgt tcgagctgtc cgagcgcttc gcgatcccgg tgatcctccg catgaccacg       480
     cgcgtctgcc actcgaagac gctggccgcg cgccgcgccg acctgcccgc cccgcccgcg       540
     ccggcgttcg tgcgcgacat ccccggccgc gtgatgatcc cggcgtacgc ccgccccgcg       600
     caccgccggc tccgcaagaa gctggaggcg ctccaggcgt tcgccgagga gaccccgctc       660
     aacgtctggg tgaagggcga tcgcgcgctc ggcgtcatca cctccggcgt gaccgcgcgg       720
     cacgtggccg aggccgcgcc ctcggcgagc cggctcgagt tgaagaccgt ctacccgctc       780
     cccctcgaga agatccgcgc cttcgcggcc agcgtcgatc gctgcgtggt ggtggaggag       840
     ggcgaccccg tcttcgccga cgcgatccgc gccgcgggca tcgcggtgga gtcgaaggag       900
     gcgccgtacc gcttcggcga gctggacgtg cagcgcgtgc gccgcatcct ggcccgcgac       960
     ccgtcgcccg agccggagct gccgaagggc cggccgccgg cgctgtgcga ggcctgcccg      1020
     taccacccgg tctacgccac gctccgcaag ctcgactgca tcgtggcggg cgacatcggc      1080
     tgctacacgc tgggcgtcct gccgccgtac cagggcatcg acacctgcgt cgccatgggc      1140
     gcctcgctcg gcgtcggcct cggcctgcgc cacgtgctgc cggaggcgga cgcgcgccgg      1200
     gtggtctcga tcatcggcga ctcgacgttc atccacaccg gcctgaacgg cctcgtcgag      1260
     atggtctaca acccgccgcc caccgggcac gtgctggtcg tgctcgacaa cggcaccacc      1320
     gccatgaccg gccagcagga gcaccccggc accggccgca cgctcgacca cgagcccacc      1380
     ggcaaggtgt cgatcgaggg gctggcccgg gcgctcggcg tcgcgaacgt ggacgtgatc      1440
     gaccccgtgg ccgatccggc cggctgggag gagctcctga aggagcgcct cgccgagccg      1500
     aagctgtccg tcatcatcgc gcggcggccc tgcatcctcg ccgccgccga catccgcagg      1560
     tacgagaagg cggccgacga gaagcgcgcc gcgctggcgt gcgcgggctg cgccggcgcc      1620
     ggggaggtgt ccgatgccta g                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page