(data stored in ACNUC7421 zone)

EMBL: CP000251.PE408

CP000251.PE408       Location/Qualifiers
FT   CDS_pept        480509..481411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0410"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80186"
FT                   /db_xref="GOA:Q2IN08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80186.1"
FT                   /translation="MKLRHVLPLIIGFVFVPAALMLTVGILILVYGSVARDYLFGILIV
FT                   SLVGTTIIGSAATLAVLFREARVAKLQTDFVNKVSHELRTPLTSIRMFVETLQLGRLQD
FT                   PQRQREALEIVAEETARLSGLINRLLDWARMESGRRVYELSRQPLGPILDAALAAFEPQ
FT                   QLHHPVQLELDLPSRLPSVMADRSALVEAVLNLLNNAFKYTGAEKRIRLSAVASGPTVT
FT                   IAVTDNGPGIPQRDQKHVFDKFYRASDPLKRTVEGTGLGLAMVKHIVIGHGGKVSVESE
FT                   PGRGATFVIALPVAGGTHG"
     ttgaagctcc gccacgtcct tccgctcatc atcggcttcg tcttcgtgcc cgccgccctc        60
     atgctgacgg tggggatcct gatcctcgtc tacggctcgg tggcccggga ctacctgttc       120
     ggcatcctga tcgtctcgct ggtcggcacc accatcatcg gcagcgcggc caccctggcg       180
     gtgctgttcc gagaggcgcg cgtcgcgaag ctgcagaccg acttcgtgaa caaggtgagc       240
     cacgagctcc gcaccccgct cacctccatc cgcatgttcg tcgagacgct ccagctcggc       300
     cgcctccagg acccgcagcg gcagcgcgag gccctcgaga tcgtcgcgga ggagaccgcg       360
     cggctctccg ggctcatcaa ccgcctgctc gactgggcgc gcatggagtc cggccggcgc       420
     gtgtacgagc tctcccggca gccgctcggc ccgatcctgg acgcggcgct cgccgcgttc       480
     gagccgcagc agctgcacca cccggtgcag ctcgagctgg acctcccgtc gcgcctgccc       540
     tcggtgatgg cggaccgctc ggccctggtc gaggcggtgc tgaacctgct caacaacgcg       600
     ttcaagtaca ccggggcgga gaagcggatc cggctctcgg ccgtggcgag cgggcccacc       660
     gtgaccatcg ccgtgaccga caacgggccc gggatcccgc agcgcgacca gaagcacgtg       720
     ttcgacaagt tctaccgggc ctccgacccg ctcaagcgca cggtggaggg caccgggctc       780
     gggctggcca tggtgaagca catcgtgatc gggcacggcg ggaaggtgtc ggtcgagagc       840
     gagcccgggc gcggcgcgac cttcgtcatc gcgctgccgg tggccggagg gacccatggc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page