(data stored in ACNUC7421 zone)

EMBL: CP000251.PE412

CP000251.PE412       Location/Qualifiers
FT   CDS_pept        485743..487371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0414"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80190"
FT                   /db_xref="GOA:Q2IN04"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80190.1"
FT                   /translation="MNLLTVVTFLPLLGALAMVLVPRDEPSQHRALALVVSLVTFALSL
FT                   GLWFGFDASPGAPEFQFELMIPWMPTIGIGFHVGLDGVALLLFMLTTVLMPVVVLSAWK
FT                   AVGDRVKEFMIALLVLESAMLGTFIALDLVLFYVFWEAMLIPMYLLIGIWGSQNRLYAT
FT                   VKFFVYTFAASVLMLLAILYVYFHDGGTFDYVEARRALAVTPGAASWLFLAFALAFAVK
FT                   VPMFPLHTWLPDAHTEAPTAGSVILAGVLLKMGTFGFFRYALPLFPEAALQHRNLVAVL
FT                   AVIGIIYGALMSLVQTDMKRLVAYSSVSHLGFVMLGLMALSAEGMTGSVYQMLNHGVST
FT                   GALFLLVGMLYERRHTRLISEYGGIAKRVPVIAAAFVIVTLSSIGLPGTNGFVGEFLIL
FT                   SGTWLSRLGGSAVFATVAALGVILGAVYMLLLVEKVFFGPNQNAANHHLPDLSVREGFV
FT                   LAPMIALIVVMGLLPGPFLAPAKPAVDRLIQRFQVAEARLGKGPQVGTAVPAVMVRAPA
FT                   PAPAAEPAPLPAPAPVPLQQPGGNY"
     gtgaacctgc tcaccgtcgt caccttcctc ccgctgctcg gcgcgctcgc gatggtgctc        60
     gtcccgcggg acgagccgtc gcagcaccgg gcgctcgcgc tggtggtctc gctcgtcacg       120
     ttcgcgctgt cgctgggcct ctggttcggc ttcgacgcga gccccggcgc gcccgagttc       180
     cagttcgagc tcatgatccc gtggatgccc accatcggca tcggcttcca cgtcggcctc       240
     gacggcgtgg cgctgctcct gttcatgctc accaccgtgc tcatgccggt ggtggtcctc       300
     tccgcctgga aggcggtggg cgaccgcgtg aaggagttca tgatcgcgct gctggtgctc       360
     gagagcgcca tgctcggcac cttcatcgcg ctcgacctgg tgctcttcta cgtgttctgg       420
     gaggcgatgc tcatcccgat gtacctgctc atcgggatct ggggctcgca gaaccgcctc       480
     tacgcgacgg tgaagttctt cgtgtacacg ttcgcggcca gcgtgctgat gctgctcgcc       540
     atcctgtacg tgtacttcca cgacggcggc acgttcgact acgtcgaggc gcggcgcgcg       600
     ctggcggtga cgcccggcgc ggcgagctgg ctgttcctcg ccttcgcgct cgccttcgcg       660
     gtcaaggtgc cgatgttccc gctgcacacc tggctgccgg acgcgcacac cgaggcgccc       720
     accgccggct cggtgatcct ggccggcgtg ctcctgaaga tgggcacgtt cggcttcttc       780
     cgctacgcgc tgccgctctt cccggaggcg gcgctgcagc accgcaacct ggtcgcggtg       840
     ctggcggtca tcggcatcat ctacggcgcg ctcatgtcgc tcgtgcagac cgacatgaag       900
     cggctggtgg cctactcctc ggtctcccac ctcggcttcg tgatgctggg cctgatggcc       960
     ctctccgccg aggggatgac cgggtccgtc taccagatgc tgaaccacgg cgtgtccacc      1020
     ggcgcgctgt tcctcctggt cggcatgctc tacgagcggc gccacacccg cctcatctcg      1080
     gagtacggcg gcatcgccaa gcgcgtgccg gtgatcgcgg cggcgttcgt gatcgtgacg      1140
     ctctcctcga tcggcctccc cggcacgaac ggcttcgtgg gcgagttcct gatcctgtcc      1200
     ggcacctggc tctcgcgcct gggcggctcg gcggtgttcg ccacggtcgc ggccctcggc      1260
     gtcatcctgg gcgcggtcta catgctgctg ctcgtcgaga aggtgttctt cgggccgaac      1320
     cagaacgccg cgaaccacca cctcccggac ctctccgtcc gcgagggctt cgtgctcgcc      1380
     ccgatgatcg cgctgatcgt ggtgatgggc ctgctgcccg ggccgttcct ggcgccggcc      1440
     aagccggcgg tggaccggct catccagcgc ttccaggtgg ccgaggcgcg cctcggcaag      1500
     gggccgcagg tgggcaccgc ggtgccggcg gtgatggtcc gcgcgcccgc gccggccccg      1560
     gcggcggagc ccgccccgct gcccgcgccg gcgccggtcc cgctccagca gcccggaggg      1620
     aactactga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page