(data stored in ACNUC7421 zone)

EMBL: CP000251.PE413

CP000251.PE413       Location/Qualifiers
FT   CDS_pept        487373..488848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0415"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80191"
FT                   /db_xref="GOA:Q2IN13"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80191.1"
FT                   /translation="MSGFPTQDFVALVPVAILTMGALVLLMTEVFLTSGRRAYQAYLTM
FT                   VFAAAAAAYAAWMPVPGNVFGRQAVVDSFSAFVTVVLCAGLALSALVGQSWLNARNSER
FT                   GEFYALALFGTAGMVLLGMATDLLIAFIAVEVMSLSTYCLAAFLRRGKKPAEAAFKYVV
FT                   LGSISSALLLYGSALLYGASGSTLFSLLPRGQGSALYLAGIALVAGGVAFKIAAVPFHA
FT                   WTPDVYEGAPTPVTAFMAAGVKTAAFAVLVRLFLATESGSAAMSTSLGTVLSALAVLTM
FT                   IFGNLLALPQRSVKRMLAYSSIGHAGYLLVGVVSAVVAGARDKALAGLLFYLAAYTATV
FT                   IGAFAVVGALERRTRGDFEPADAWDLDRFAGLARRRPALAFAMAVFLFSLAGVPPTAGF
FT                   IGKFYIFKAAMGAGLYGLAVLGVLTSVLGAYYYLRVVLYMYFLPSKDEAGEVVLSAPSL
FT                   TIALAAAVAVVVLLGVVADPMVRLAQAASAIIL"
     atgagcggct tcccgaccca ggacttcgtc gcgctggtcc cggtggcgat cctcacgatg        60
     ggggcgctgg tcctgctgat gaccgaggtg ttcctcacct cgggccggcg ggcctaccag       120
     gcctacctga ccatggtgtt cgcggccgcc gccgcggcct acgccgcctg gatgccggtg       180
     cccggcaacg tgttcgggcg ccaggcggtg gtggacagct tctcggcctt cgtcacggtg       240
     gtgctctgcg ccggcctggc gctctcggcg ctggtgggcc agagctggct gaacgcccgc       300
     aactccgagc gcggcgagtt ctacgcgctc gcgctgttcg gcaccgccgg catggtgctg       360
     ctgggcatgg ccaccgacct gctcatcgcg ttcatcgcgg tggaggtgat gagcctctcc       420
     acctactgcc tcgccgcctt cctgcggcgc ggcaagaagc ccgccgaggc ggccttcaag       480
     tacgtggtgc tcggctcgat ctcctcggcg ctgctgctct acgggtcggc gctgctctac       540
     ggcgcctcgg gctcgacgct gttctcgctg ctgccgcgcg gccagggctc ggcgctgtac       600
     ctcgccggca tcgcgctggt ggccggcggc gtcgccttca agatcgccgc ggtcccgttc       660
     cacgcctgga cccccgacgt ctacgagggc gcgcccaccc cggtgaccgc gttcatggcc       720
     gccggcgtga agaccgcggc cttcgcggtg ctggtccgcc tgttcctggc caccgagagc       780
     ggctcggccg ccatgtccac ctcgctcggc acggtgctct ccgcgctggc cgtgctcacg       840
     atgatcttcg gcaacctgct ggcgctgccg cagcgcagcg tgaagcggat gctggcgtac       900
     tcgtcgatcg gccacgccgg ctacctgctg gtgggcgtgg tctccgcggt ggtggcgggc       960
     gcgcgcgaca aggcgctcgc gggcctgctg ttctacctcg cggcctacac cgccaccgtc      1020
     atcggcgcgt tcgccgtggt cggcgcgctg gagcgccgga cccggggcga cttcgagccg      1080
     gccgacgcgt gggacctcga tcgcttcgcc ggcctggcgc ggcgccgccc ggcgctcgcg      1140
     ttcgcgatgg cggtgttcct gttctcgctc gcgggcgtgc cgcccaccgc cggcttcatc      1200
     gggaagttct acatcttcaa ggcggccatg ggcgccggcc tctacggcct ggcggtgctg      1260
     ggcgtgctca ccagcgtgct cggcgcgtac tactacctgc gcgtcgtcct ctacatgtac      1320
     ttcctgccgt cgaaggacga ggccggcgag gtggtgctct cggcgccgtc gctcaccatc      1380
     gcgctggccg cggcggtggc ggtggtggtc ctgctcggcg tggtggccga cccgatggtg      1440
     cggctggccc aggcggcgag cgccatcatc ctgtag                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page