(data stored in ACNUC7421 zone)

EMBL: CP000251.PE419

CP000251.PE419       Location/Qualifiers
FT   CDS_pept        complement(498393..499280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0421"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80197"
FT                   /db_xref="GOA:Q2IN16"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80197.1"
FT                   /translation="MTDRLCRGLLPQRGLRAVFVRVGDTARMARVLHGLYPTSAHLFAQ
FT                   GLAAGALLGALQKEQGRVNFQIECDGPVGGLFVDADRDGNVRGYVRRPAVHFPGDPDRA
FT                   ARAALGGSGFLSVLRDPGSGQYYRSAVELEALDVAEDLRRWFAASEQVETALDLAVVGR
FT                   DGEPLAEVGGLLLQKLPDGDAAAIGAARERLAAGALRAALARGATAQEVIRDVAGDGFE
FT                   LLADEEVAYRCGCSPERARAAVSALGREGIEQVLAEEKQAVISCEFCRQRYVIGEAELR
FT                   DIARRLAERDAQGG"
     atgaccgacc gcctctgccg tggcctcctc ccgcagcgcg ggctccgcgc cgtcttcgtc        60
     cgcgtgggcg acaccgcccg catggcgcgg gtgctccacg gcctctaccc gacgagcgcc       120
     cacctgttcg cccaggggct ggcggccggg gcgctgctcg gcgcgctgca gaaggagcag       180
     gggcgcgtga acttccagat cgagtgcgac ggcccggtgg gcgggctgtt cgtggacgcc       240
     gatcgcgacg gcaacgtgcg cggctacgtg cgccgcccgg cggtccactt cccgggggat       300
     ccggaccgcg ccgcgcgcgc cgccctgggc ggctccgggt tcctgtcggt gctgcgcgac       360
     cccgggagcg gccagtacta ccggagcgcg gtggagctcg aggcgctcga cgtggccgag       420
     gacctgcggc gctggttcgc cgcgagcgag caggtggaga cggcgctcga cctcgcggtg       480
     gtggggcgcg acggcgagcc gctcgccgag gtgggcgggc tgctcctgca gaagctgccc       540
     gacggcgacg cggccgcgat cggggccgcg cgcgagcggc tcgccgcggg cgcgctccgg       600
     gccgccctgg cccgcggcgc gaccgcgcag gaggtcatcc gcgacgtggc gggggacggc       660
     ttcgagctgc tcgccgacga ggaggtcgcg taccggtgcg gctgcagccc ggagcgggcc       720
     cgcgcggcgg tgtccgcgct cgggcgggag ggcatcgagc aggtgctcgc ggaggagaag       780
     caggcggtca tctcctgcga gttctgccgc cagcgttacg tgatcggcga ggcggagctc       840
     cgcgacatcg cccggcggct ggcggagcgg gacgcgcagg gcgggtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page