(data stored in ACNUC7421 zone)

EMBL: CP000251.PE42

CP000251.PE42        Location/Qualifiers
FT   CDS_pept        52424..53530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0042"
FT                   /product="butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79820"
FT                   /db_xref="GOA:Q2ILY5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79820.1"
FT                   /translation="MSASAGPHGPLVLAVNPGAGSTKLGLFRGGGLVREEKVLHPEAMA
FT                   RPAARIWDELPGRVAAAEDFLARAGVRAGDLAAVAGRGGLLPPLAAGAYLVDDALVAEL
FT                   ERAAHGEHASNLGAPMARALAAPHGCPALVVDPVSVDELAPVARVTGLAGVERTSFAHA
FT                   LNLRAVARRHAASAGRPLEALALVLAHLGTGISLCALAGGRMVDVVNPRDEGPFSGDRA
FT                   GGVPATALVDLCFAPGADARTVKRRLFGDGGLYAHLGTRDVREALARAGRGDARAALLV
FT                   DAMCYQAAKAVAAMAVALDGRVDAIVLTGGLAHLAPVVEGVRRRVAWIAPVEVHPGEDE
FT                   LRALAEGALRVLSGEEPARPYAPLAPDR"
     gtgagcgcca gcgcggggcc gcacgggccg ctggtgctcg cggtgaaccc gggggccggg        60
     tccaccaagc tcggcctgtt ccgcgggggc gggctggtcc gcgaggagaa ggtgctgcac       120
     cccgaggcga tggcgcggcc cgcggcgcgg atctgggacg agctgcccgg gcgcgtcgcc       180
     gcggcggagg acttcctcgc tcgcgccggg gtgcgggcgg gcgacctcgc cgcggtggcc       240
     gggcgcggcg ggctgctccc gccgctcgcc gccggcgcgt acctcgtgga cgacgcgctc       300
     gtcgccgagc tggagcgggc cgcgcacggg gagcacgcct cgaacctggg cgcgcccatg       360
     gcgcgggcgc tcgccgcgcc gcacgggtgc ccggcgctgg tcgtggaccc ggtctcggtg       420
     gacgagctcg cgccggtggc gcgcgtcacc ggcctcgccg gggtggagcg caccagcttc       480
     gcgcacgcgc tcaacctgcg cgcggtggcg cggcgccacg cggcctcggc cggccggccg       540
     ctcgaggcgc tcgcgctcgt gctcgcgcac ctcggcaccg gcatctcgct ctgcgccctg       600
     gccggcggcc ggatggtgga cgtggtgaac ccgcgcgacg aggggccgtt ctccggcgac       660
     cgggccggcg gcgtgccggc caccgcgctc gtggacctgt gcttcgcgcc gggcgccgac       720
     gcacggacgg tgaagcggcg gctgttcggc gacggcgggc tctacgcgca cctcggcacg       780
     cgcgacgtcc gcgaggcgct ggcgcgggcc gggcgcgggg acgcccgggc cgcgctgctc       840
     gtggacgcga tgtgctacca ggccgcgaag gccgtggcgg cgatggccgt cgcgctcgac       900
     ggccgggtgg acgcgatcgt gctcaccggc ggcctcgccc acctcgcgcc ggtggtcgag       960
     ggcgtccggc gccgggtggc gtggatcgcg ccggtggagg tccacccggg cgaggacgag      1020
     ctgcgggcgc tcgccgaggg cgcgctgcgc gtcctctcgg gcgaggagcc ggcgcggccc      1080
     tacgcgccgc tcgcgcccga tcgctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page