(data stored in ACNUC7421 zone)

EMBL: CP000251.PE420

CP000251.PE420       Location/Qualifiers
FT   CDS_pept        complement(499461..500063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80198"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80198.1"
FT                   /translation="MRVARRYRRPMRTPALLRLSVLCAGLLAAAAARAQDVPFEPSGEV
FT                   RILAWGTMGTSAAFDEGRIVGPTVNLTRREDGTWAGDLAGRNVSLEIREGRLSGANVNL
FT                   VLTQKGTATHGEGLFYGVRFRFDLDGKRLSARFGDCTVDAKRLKAPGQLRGDAACLRRG
FT                   ASFPSSSRATVQLIGDAANEPPPLPQLALALLATMAG"
     gtgagggttg cgcggcgtta tcgtcgcccc atgcgtaccc ctgccctgct gcgcctctcg        60
     gtcctgtgcg ccggcctgct cgcggccgcc gcagcgcgcg cccaggacgt gcccttcgag       120
     ccctccggcg aggtccgcat cctggcctgg ggcaccatgg ggacgagcgc cgccttcgac       180
     gagggacgca tcgtcgggcc gaccgtgaac ctcacccggc gcgaggacgg cacctgggcc       240
     ggcgacctcg ccggccgcaa cgtctcgctc gagatccgcg agggccggct ctccggggcg       300
     aacgtgaacc tggtgctcac gcagaagggc accgcgacgc acggcgaggg gctgttctac       360
     ggcgtgcgct tccgcttcga cctcgacggc aagcggctct cggcgcgctt cggcgactgc       420
     accgtggacg cgaagcgcct gaaggcgccg ggccagctcc gcggcgacgc ggcctgcctg       480
     cggcgcggcg cgtccttccc gtcgagctcc cgcgccaccg tgcagctcat cggcgacgcc       540
     gcgaacgagc cgcccccgct gccgcagctc gcgctggcgc tgctcgcgac catggccggc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page