(data stored in ACNUC7421 zone)

EMBL: CP000251.PE426

CP000251.PE426       Location/Qualifiers
FT   CDS_pept        complement(507601..508872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0428"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80204"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80204.1"
FT                   /translation="MRSHDARAAAMGGTGHAGGVIHVPAVADEPSPAPADLASLTQAQR
FT                   AERALAEGRREREIPIERAFLQAALDFRQTLRVLVSAVVPKFADWCFVDLIDGDGIPRR
FT                   VEVAHGDPAKAPLAQEMRSIAFGPGWATPGAQTIRDRAPRLFRQVTTEVMEWATHGERH
FT                   LAVLRAIKPNSLLSVPLVARDRVIGSITLIRSNMLPGLDEADMVFAEALAEPAALALDN
FT                   ARWYQAEKAGRGAALEEADRERHDRVEAQRGVLRLRRIESVSASLASVLAPQAIARVAV
FT                   ENGLSVLEPATAMVVRAAPGASVLEVLHCQGWADDLTIDLRELRADAPALLAEAYRIQT
FT                   AIWVSSPEALAHSYPNAAELALRVGDRAWAAVPLRCDGRTVGALGLGFPHPRDLDADEK
FT                   RFVLTVAQIVAQALERARLRDEAR"
     atgcggtctc acgacgcgcg ggcggcggcg atgggcggga cgggccacgc tggcggggtg        60
     atccacgtcc cggcggtggc cgacgagccg tctcctgcgc cggcggatct ggcgagcctc       120
     acgcaggcgc agcgcgccga gcgcgcgctg gccgagggca ggcgcgagcg ggagatcccc       180
     atcgagcgcg cgttcctgca ggcggcgctc gacttccggc agacgctccg cgtgctggtc       240
     tcggcggtgg tgccgaagtt cgccgactgg tgcttcgtgg acctcatcga cggggacggg       300
     atcccgcgcc gcgtggaggt cgcgcacggg gatccggcca aggcgccgct cgcccaggag       360
     atgcgctcga tcgcgttcgg gccgggctgg gccacccccg gcgcgcagac catccgcgac       420
     cgcgccccgc gcttgttccg gcaggtgacg accgaggtga tggagtgggc cacccacggc       480
     gagcgccacc tggcggtgct gcgcgccatc aagcccaact cgctgctgtc ggtcccgctc       540
     gtcgcgcgcg accgggtcat cgggtccatc acgctcatcc gctcgaacat gctcccgggc       600
     ctcgacgagg ccgacatggt gttcgccgag gcgctggccg agccggccgc gctcgcgctc       660
     gacaacgccc gctggtacca ggccgagaag gccgggcgcg gggccgcgct ggaggaggcg       720
     gaccgcgagc ggcacgatcg cgtggaggcg cagcgcgggg tgctgcggct gcgccggatc       780
     gagtcggtct cggccagcct ggcgtcggtg ctcgcgccgc aggccatcgc gcgggtggcg       840
     gtggagaacg ggctctcggt gctggagccg gccaccgcga tggtggtccg cgcggcgccc       900
     ggcgcgagcg tgctcgaggt gctgcactgc cagggctggg ccgacgacct gacgatcgac       960
     ctgcgcgagc tgcgggccga cgcgccggcg ctgctcgccg aggcctaccg catccagacc      1020
     gccatctggg tctccagccc ggaggcgctg gcgcactcct accccaacgc cgccgagctg      1080
     gcgctccggg tgggcgaccg cgcctgggcg gcggtgccgc tccgctgcga cggccgcacg      1140
     gtcggcgcgc tgggcctcgg gttcccgcac ccgcgcgacc tcgacgcgga cgagaagcgc      1200
     ttcgtgctca cggtggcgca gatcgtggcg caggcgctgg agcgcgcccg gctccgcgac      1260
     gaggcgcggt ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page