(data stored in ACNUC7421 zone)

EMBL: CP000251.PE427

CP000251.PE427       Location/Qualifiers
FT   CDS_pept        complement(508991..510007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0429"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80205"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80205.1"
FT                   /translation="MRVESAPGAGGHLPVEQRSERTWTTLPSTPCAAGRRHAFLLVLAG
FT                   PQLGEIYPLAPDRELVIGRRDDCDLPIRDDGVSRRHAAIRVEGEGAVLRDLGSANGTYV
FT                   DGARAEGEVRLADGGRVSLGGATVLKFAWADELEARWQMKLAEIALLDPLTGVFNRRHL
FT                   DDRLAAELAAAQRHGRSMSVLLVDVDRFRAVNEAHGQAAGDEALKMVAFVLRGALRRED
FT                   VLARAGGASFAVIARETTLAGGRALGERIRRAVARSRCAWQPEGGGEAASIGVKVSVGV
FT                   AEVAEGRTQREVMESAGRALQLAKQAGRNTVVAIPMAPAEGRPDPAQAAMTRGGAAP"
     gtgcgggtag aatccgcccc cggcgcggga ggccacttgc cggtcgagca gaggagcgag        60
     cgcacctgga cgacgttgcc gagcacgccg tgcgcggcgg ggcggcgcca cgcgttcctc       120
     ctggtgctgg cgggcccgca gctcggggag atctacccgc tcgcccccga ccgcgagctc       180
     gtcatcggcc ggcgcgacga ctgcgatctc cccatccgcg acgacggggt gtcgcgccgc       240
     cacgcggcca tccgcgtcga gggcgagggc gcggtgctgc gcgacctcgg cagcgcgaac       300
     ggcacctacg tggacggcgc gcgcgccgag ggcgaggtgc ggctcgccga cggcggccgg       360
     gtgagcctgg gcggcgcgac cgtgctcaag ttcgcctggg ccgacgagct cgaggcgcgc       420
     tggcagatga agctcgccga gatcgcgctg ctcgatcccc tcaccggcgt gttcaaccgc       480
     cgccacctcg acgaccggct cgccgccgag ctcgccgcgg cgcagcggca cggccggtcc       540
     atgtcggtgc tgctggtgga cgtggaccgg ttccgcgccg tgaacgaggc gcacggccag       600
     gccgccggcg acgaggcgct gaagatggtc gcgttcgtgc tccgcggcgc gctccgccgc       660
     gaggacgtgc tggcgcgcgc cggcggcgcg tcgttcgccg tgatcgcgcg cgagacgacg       720
     ctcgcgggcg ggcgggcgct cggcgagcgc atccggcgcg cggtggcgcg gagccgctgc       780
     gcctggcagc cggagggcgg cggcgaggcg gcctccatcg gcgtgaaggt ctcggtgggc       840
     gtggcggagg tcgccgaggg gcgcacgcag cgcgaggtga tggagtcggc cgggcgggcg       900
     ctccagctcg cgaagcaggc gggccggaac accgtggtgg cgatcccgat ggcgcccgcg       960
     gaggggcggc ctgatcccgc gcaagcggcc atgacgcgcg gcggcgcggc gccttga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page