(data stored in ACNUC7421 zone)

EMBL: CP000251.PE432

CP000251.PE432       Location/Qualifiers
FT   CDS_pept        complement(518184..519470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0434"
FT                   /product="Exodeoxyribonuclease I subunit D"
FT                   /EC_number="3.1.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80210"
FT                   /db_xref="GOA:Q2IN32"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80210.1"
FT                   /translation="MSDRRVSSMASVALRILHTADWHLGHALHGVDRGPEHERFVAWLL
FT                   DTAEAEAVDAVIVAGDVFDAANPPAGAQALWYRFLAEAWRRLPRLQLVVVGGNHDSASR
FT                   LDAVDPLLREMGRLHVVGGVPRGGAGAPDLEKLLVPLEDAAGRRAAWVAAVPYLRAADL
FT                   GAGAADADAAEATRRFYAAALERARARRAPGEALLATGHLYAVGGKTSELSERRLAVGN
FT                   QAAVPADAFPADLAYVALGHLHLAQAVGGRETVRYSGSALPLSFGERGYRHGVVVADLD
FT                   GEAVRAQRVLRVPRFVELVSVPDGEAPAPLPEVLAALEALPARGEGPDALRPLLEVKVR
FT                   LERPEPALRALLDQALAGKEARLVRIATTLAGTGRALGDGERRALGDLVPEDVFRRKYD
FT                   ADYGGPPPDALLEAFRALLQEVESEEGAR"
     atgtccgacc ggcgcgtatc ctccatggcg tccgtggccc tccgcatcct ccacaccgcc        60
     gactggcacc tcggccacgc gctccacggc gtggaccgcg gccccgagca cgagcgcttc       120
     gtggcgtggc tgctcgacac cgccgaggcc gaggcggtgg acgcggtgat cgtggccggc       180
     gacgtgttcg acgccgccaa cccgcccgcc ggcgcccagg cgctctggta ccggttcctg       240
     gccgaggcct ggcgtcgcct gccgcgcctg cagctcgtgg tggtgggcgg gaaccacgac       300
     tccgcctcgc gcctcgacgc ggtggatccg ctcctgcgcg agatgggccg cctgcacgtg       360
     gtgggcgggg tgccgcgcgg cggcgcgggc gcgcccgatc tggagaagct gctcgtgccg       420
     ctggaagacg cggcgggccg gcgggcggcc tgggtggcgg cggtgccgta cctgcgcgcc       480
     gccgacctgg gcgcgggcgc cgccgacgcc gacgcggccg aggcgacgcg ccggttctac       540
     gccgcggcgc tggagcgggc gcgggcgagg cgcgcgccgg gcgaggcgct cctcgccacc       600
     ggccacctct atgcggtggg cgggaagacc tcggagctgt ccgagcggcg gctcgcggtg       660
     ggcaaccagg ccgcggtgcc cgccgatgcg ttccccgccg acctcgccta cgtcgcgctc       720
     ggccacctgc acctcgcgca ggcggtgggc gggcgcgaga cggtgcgcta ctcgggctcg       780
     gcgctgccgc tctcgttcgg cgagcgcggc taccgccacg gcgtggtggt ggccgacctg       840
     gacggcgagg cggtgcgcgc gcagcgggtg ctgcgcgtcc cgcgcttcgt ggagctcgtc       900
     tcggtgccgg acggggaggc gccggcgccg ctcccggagg tgctcgcggc gctcgaggcg       960
     ctgccggcgc gcggcgaggg gccggacgcg ctgcggccgc tgctcgaggt gaaggtgcgg      1020
     ctggagcggc ccgagccggc gctgcgcgcg ctgctcgacc aggcgctcgc gggcaaggag      1080
     gcgcgcctcg tgcgcatcgc caccacgctc gccggcaccg gccgcgcgct gggcgacggc      1140
     gagcggcgcg cgctcggcga cctcgtgccg gaggacgtct tccggcggaa gtacgacgcc      1200
     gactacggcg gcccgccgcc ggacgcgctg ctggaggcct tccgcgcgct gctgcaggag      1260
     gtggagtcgg aggagggggc gcggtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page