(data stored in ACNUC7421 zone)

EMBL: CP000251.PE441

CP000251.PE441       Location/Qualifiers
FT   CDS_pept        complement(526334..526864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0443"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80219"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80219.1"
FT                   /translation="MTQHVKAAIEGLAAAVTAEPHRARATFRATTISEGAGLATRSVVR
FT                   GFEVPLDEPRELGGTDTGPNPVEAVLAALGSCQAIVYRALAAAQGLQLERVEVVATGVL
FT                   DVRGFLGAAPVSPGFERVTFRTRLTSPEPLERLRALARQVEAQCPVLDVLQRPLDVRGE
FT                   LELVSIPAAGRAA"
     atgacccagc acgtgaaggc ggcgatcgag gggctcgcgg cggcggtgac cgcggagccg        60
     cacagggcgc gcgcgacgtt ccgcgcgacg acgatctcgg agggcgcggg gctcgccacc       120
     cgctcggtgg tgcgcggctt cgaggtgccc ctcgacgagc cgcgcgagct cggcggcacc       180
     gacaccgggc cgaacccggt ggaggcggtg ctcgcggcgc tggggagctg ccaggccatc       240
     gtctaccgcg ccctcgccgc ggcgcagggg ctccagctcg agcgcgtcga ggtcgtggcg       300
     accggggtgc tggacgtgcg cggcttcctg ggcgcggcgc cggtgtcgcc cgggttcgag       360
     cgcgtgacgt tccggacccg gctcacgtcc cccgagccgc tggagcggct ccgcgcgctc       420
     gcccgccagg tggaggcgca gtgcccggtg ctggacgtgc tgcagcggcc gctggacgtg       480
     cgcggcgagc tggagctcgt gtcgatcccc gccgccggcc gcgcggcctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page