(data stored in ACNUC7421 zone)

EMBL: CP000251.PE445

CP000251.PE445       Location/Qualifiers
FT   CDS_pept        complement(529118..529828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80223"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80223.1"
FT                   /translation="MNPKKLLAPLSLALAALLLPTGARAHCDTLDGPVVVAAKAALDSG
FT                   KLSPVLAWVQPADEAEIKAAFAKARAARKAGGDAREVADTWFLETLVRVHRAGEGAPFT
FT                   GLKPAGGDLDPAVAAMDRAIAKGDPAEVERLLQAAVHQGLEKHWTRLAAEKAPADDVNA
FT                   GRRWVAAYVPLVHWAEGVNAAATKGGAHAGHAQAGAADPHAAHAAPAADPHAAHGRAPA
FT                   KAPVKPAADAKHAH"
     gtgaacccga agaagctgct cgcccccctc tccctcgcgc tcgccgcgct gctcctcccg        60
     accggcgccc gcgcgcactg cgacaccctc gacggcccgg tggtggtggc cgcgaaggcc       120
     gcgctcgact ccggcaagct gtcccccgtg ctggcgtggg tgcagcccgc cgacgaggcc       180
     gagatcaagg ccgcgttcgc gaaggcccgc gccgcgcgca aggccggcgg cgacgcccgc       240
     gaggtcgccg acacctggtt cctcgagacg ctggtccgcg tgcaccgcgc cggcgagggc       300
     gcgccgttca cgggcctcaa gcccgccggc ggcgacctcg accccgccgt cgccgccatg       360
     gaccgcgcca tcgcgaaggg cgatccggcc gaggtggagc ggctgctcca ggcggcggtg       420
     caccagggcc tggagaagca ctggacccgg ctggccgccg agaaggcgcc cgcggacgac       480
     gtgaacgccg gccgccgctg ggtggccgcc tacgtgccgc tcgtgcactg ggccgagggc       540
     gtgaacgccg ccgccacgaa gggtggtgcc cacgccgggc acgcccaggc cggcgccgcg       600
     gatccgcacg ccgcccacgc ggcgcccgcg gccgacccgc acgccgcgca cggccgggcg       660
     cccgccaagg cccccgtgaa gccggctgcg gacgcgaagc acgcgcacta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page