(data stored in ACNUC7421 zone)

EMBL: CP000251.PE447

CP000251.PE447       Location/Qualifiers
FT   CDS_pept        complement(530605..531312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80225"
FT                   /db_xref="GOA:Q2IN42"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80225.1"
FT                   /translation="MWEAVAITFRESFQRLAVNAARLVPGLLATLVFALLSLALAWACA
FT                   RLVRRILKAVQLDRLLRRWAPAEDRARLPSLVTYATRFAFWLVFAIGLALSLTSVESRW
FT                   TSALAERVLAYAPSVIVAGVLFAAAVALSRWVEASVLVSAVNMQIRSARLLATGARWLV
FT                   TVLGGAMALQHLGVGGALVTISFSILFGGIVLALALAVGLGSREVVTRSWERRLRDRDE
FT                   AHHDEEPPRIAHL"
     atgtgggaag cggtcgcgat cacgttccgc gagtcgttcc agcggctcgc cgtcaacgcc        60
     gcgcggctgg tgcccggcct gctcgccacg ctggtcttcg cgctgctctc gctcgcgctc       120
     gcgtgggcct gcgcgcgcct ggtgcgccgc atcctgaagg cggtccagct cgaccggctc       180
     ctgcgccggt gggcgcccgc cgaggaccgc gcccggctgc cgtcgctcgt cacctacgcc       240
     acccgcttcg ccttctggct cgtgttcgcg atcggcctcg cgctcagcct gacctcggtc       300
     gagtcgcgct ggacgagcgc gctcgcggag cgcgtgctcg cctacgcgcc cagcgtcatc       360
     gtggcgggcg tgctgttcgc cgcggcggtg gcgctgtcgc gctgggtgga ggcgagcgtg       420
     ctggtgagcg cggtgaacat gcagatccgc tcggcccggc tgctcgccac cggcgcgcgc       480
     tggctggtga cggtgctggg cggcgccatg gcgctgcagc acctcggggt gggcggcgcg       540
     ctcgtcacca tctcgttctc gatcctgttc ggagggatcg tgctggcgct ggcgctggcg       600
     gtggggctcg gctcgcgcga ggtggtgacg cgctcgtggg agcggcgcct gcgcgatcgc       660
     gacgaggcgc accacgacga ggagccgccc cgcatcgcgc acctgtag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page