(data stored in ACNUC7421 zone)

EMBL: CP000251.PE452

CP000251.PE452       Location/Qualifiers
FT   CDS_pept        536847..537638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80230"
FT                   /db_xref="GOA:Q2IN46"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80230.1"
FT                   /translation="MPEPTQPERRPLRGGDVAAIVLALAVAGAIAYFWFHRQRALPPPS
FT                   PAVPEQAAPEAKPPDAALPAAVQADPAQVKSLLEAASADPEYRRWLAAGGDLVRLWAVL
FT                   TDNLAEGVSPRKQLPFLVPEQPFSVAEQGGRQVIAPASYARYDRFADAVASIDPKATAA
FT                   AYRALRPAVETAYRLLGYPDAVLDRVTARALHRLEAAPRPAGPVAVVPHAEAGAGWAYA
FT                   DPVLEHLGAVEKHLLRMGPRNAGKVQAKAREIREALGLRER"
     atgcccgagc ccacccagcc cgagcgccgc ccgctgcgcg gcggcgacgt cgcggccatc        60
     gtgctcgcgc tggcagtggc cggcgcgatc gcctacttct ggttccaccg tcagcgcgcg       120
     ctgccgccgc cctcgcccgc ggtgccggag caagccgccc ccgaggcgaa gcccccggac       180
     gcagccctgc cggccgcggt ccaggccgac ccggcgcagg tgaagtcgct cctcgaggcc       240
     gcctccgcgg atccggagta ccgccgctgg ctcgctgcgg ggggcgacct cgtccggctc       300
     tgggcggtgc tcacggacaa cctggccgag ggcgtctcgc cccggaagca gctcccgttc       360
     ctggtgccgg agcaaccgtt ctcggtggca gagcagggcg gccggcaggt gatcgcccct       420
     gcgtcgtacg cccgctacga ccgcttcgcc gacgcggtgg cgtcgatcga ccccaaggcg       480
     accgccgccg cctaccgcgc gctgcgaccg gccgtcgaga ccgcctaccg actgctgggc       540
     taccccgacg ccgtgctcga ccgcgtcacg gcgcgcgcgc tccaccggct cgaggcggca       600
     ccgcgcccgg ccgggccggt ggcggtcgtc ccgcacgccg aggccggcgc cggatgggcc       660
     tacgcggatc cggtactcga gcacctgggg gcggtcgaga agcacctcct ccgcatgggc       720
     ccgcggaatg cggggaaggt gcaggcgaag gcgcgcgaga tccgggaggc gctgggcctc       780
     cgagagcggt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page