(data stored in ACNUC7421 zone)

EMBL: CP000251.PE453

CP000251.PE453       Location/Qualifiers
FT   CDS_pept        537820..539316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0455"
FT                   /product="ABC phosphonate transporter, ATPase subunit/LysR
FT                   type substrate-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80231"
FT                   /db_xref="GOA:Q2IN45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IN45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80231.1"
FT                   /translation="MPQRPEAARAGPVAGPDAASKPAPGPALTLRGAGRAYGPVRALRP
FT                   LTLEIRRGERVALLGPSGAGKSTLLRLLDTSLAPSEGTVEVLGQPVADTDARRLRALRA
FT                   RIGTVHQQLLLVPQATAMQNVVAGRLGRTSLARTLAALVSRREAARVRAVLDEVGIGDK
FT                   IFERVDRLSGGEQQRVAIARTLYQDPELILADEPLASVDPARAADIAALLARAFAGRTL
FT                   VVSTHRIEPLLAHVDRVVALREGALAFDKPAAALTLRDLGELYEARRGAADPARAPAAR
FT                   PPSDPVVAPGGTLRIGASSTPGEHLLPSIVRAFARAYPGTRVSLSLSDSAAVTAAVRDG
FT                   ALDLGFVGARDDDPALAYEDVARDEIVLVAAPVLELPPEPITLEVAARLPRVDREPGSG
FT                   TRAVVEQHLANMGAALDPAAVVLEAGALVALKAAVVSGMGVAFVSRRAVEDDLRGGHVR
FT                   TVRVEGLSIPRHVFAVLRRSPVPSAAARAFLEVARAEVPP"
     atgccgcagc gcccggaagc cgcccgcgcg ggtcccgtcg cggggccgga cgccgcaagc        60
     aagccggccc ccgggcccgc gctcaccctc cgcggtgccg ggcgcgccta cgggccggtg       120
     cgcgcgctcc ggccgctcac gctcgagatc cgccgcggcg agcgcgtcgc gctgctcggc       180
     ccgagcggcg ccgggaagtc cacgctgctt cgcctgctcg acacctcgct cgcgccgtcg       240
     gaggggacgg tggaggtgct gggccagccc gtggccgaca ccgatgcgcg ccgcctccgc       300
     gcgctgcgcg cgcgcatcgg gaccgtgcac cagcagctgc tcctcgtccc gcaggccacc       360
     gccatgcaga acgtggtggc cgggcggctc ggccgcacct cgctcgcgcg caccctcgcc       420
     gcgctcgtct cgcggcgaga ggcggcgcgc gtccgcgcgg tgctcgacga ggtcggcatc       480
     ggcgacaaga tcttcgagcg ggtggaccgg ctctccggcg gcgagcagca gcgcgtcgcc       540
     atcgcgcgga cgctctacca ggatccggag ctgatcctcg ccgacgagcc gctcgcctcg       600
     gtggacccgg cgcgcgccgc cgacatcgcc gcgctgctcg cgcgcgcgtt cgccggccgg       660
     acgctggtcg tctccaccca ccgcatcgag ccgctcctcg cccacgtgga ccgggtggtg       720
     gcgctgcggg agggggcgct cgcgttcgac aagccggccg cggcgctcac gctccgtgac       780
     ctcggcgagc tgtacgaggc ccggcgcggc gccgccgacc cggcgcgcgc gcccgcggcc       840
     cggccgccct ccgatcccgt ggtcgcgccc gggggcacgc tccggatcgg cgcgtccagc       900
     acgcccggcg agcacctcct gccgtcgatc gtccgcgcgt tcgcgcgcgc ctacccgggc       960
     acgcgggtga gcctgagcct gagcgactcg gcggcggtga ccgcagcggt gcgcgacggc      1020
     gcgctcgacc tcgggttcgt gggcgcccgc gacgacgacc cggcgctcgc ctacgaggac      1080
     gtggcccgcg acgagatcgt gctcgtggcc gcgccggtgc tcgagctgcc gcccgagccc      1140
     atcacgctcg aggtcgcggc ccggctgccg cgggtggatc gcgagcccgg ctccggcacg      1200
     cgcgcggtgg tggagcagca cctcgcgaac atgggcgcgg cgctcgaccc ggccgcggtg      1260
     gtgctggagg ccggcgcgct cgtggcgctg aaggcggcgg tggtctcggg catgggggtc      1320
     gcgttcgtgt cgcggcgcgc ggtcgaggac gacctgcgcg gcgggcacgt gcgcacggtg      1380
     cgggtggagg ggctctcgat cccgcgccac gtcttcgcgg tgctgcggcg cagccccgtc      1440
     ccgagcgcgg cggcgcgggc gttcctcgag gtcgcgcgcg ccgaggtgcc gccgtga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page