(data stored in ACNUC7421 zone)

EMBL: CP000251.PE455

CP000251.PE455       Location/Qualifiers
FT   CDS_pept        541082..541933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0457"
FT                   /product="ABC phosphonate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80233"
FT                   /db_xref="GOA:Q2IN52"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR030836"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80233.1"
FT                   /translation="MHRLAALAVAAVLLLPPAARALDALRVSAIPDESPTELQRKFEPL
FT                   GKYLGKQIGIPVKFVPVTDYAATVEGLAAGKLDMVWYGGFTFVQARRRTGNAIPLVQRA
FT                   EDARFHSKFIVPASSKAQSLKDLKGASFAFGSVSSTSGHLMPRYFLLQAGIDPDKDFAK
FT                   VAYSGAHDVTAKWVEAGKVDAGVVNESIWQRLVDEKKIDTSKVRVLWTTPEYQDYNWTV
FT                   RGDLDPKLVEKLRAAFLALDPAKPEDKAILDLQRASRFIPTSPDAYKNIEQAAKSAGLI
FT                   KD"
     atgcaccgcc tcgccgccct cgccgtcgcc gccgtcctgc tcctcccgcc cgccgcccgc        60
     gcgctcgacg cgctccgggt gagcgccatc cctgacgagt cgcccaccga gctgcagcgg       120
     aagttcgagc cgctcggcaa gtacctcggg aagcagatcg gcatcccggt gaagttcgtg       180
     ccggtgaccg actacgccgc caccgtggaa ggcctcgccg ccggcaagct cgacatggtc       240
     tggtacggcg gcttcacgtt cgtgcaggcg cggcgccgca ccggcaacgc catcccgctc       300
     gtgcagcgcg ccgaggacgc ccgcttccac tccaagttca tcgtgcccgc gtcatccaag       360
     gcgcagtcgc tgaaggacct gaagggcgcg agcttcgcgt tcggctcggt gagctcgacg       420
     tccggccacc tcatgccgcg ctacttcctg ctccaggccg gcatcgatcc cgacaaggac       480
     ttcgccaagg tggcgtactc cggcgcgcac gacgtgaccg cgaagtgggt ggaggccggc       540
     aaggtggacg ccggcgtggt gaacgagtcg atctggcagc ggctcgtgga cgagaagaag       600
     atcgacacca gcaaggtccg cgtgctgtgg accacgcccg agtatcagga ctacaactgg       660
     accgtccgcg gcgacctcga cccgaagctc gtcgagaagc tccgcgccgc gttcctcgcg       720
     ctcgatccgg cgaagcccga ggacaaggcc atcctcgacc tgcagcgcgc cagccgcttc       780
     atccccacct cgcccgacgc ctacaagaac atcgagcagg ccgcgaagtc ggcggggctc       840
     atcaaggact ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page