(data stored in ACNUC7421 zone)

EMBL: CP000251.PE456

CP000251.PE456       Location/Qualifiers
FT   CDS_pept        complement(541973..542617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80234"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80234.1"
FT                   /translation="MACYADSGTVSRQGRSHPSPLVTNNSSAGERQTMRFDLDVQWCPA
FT                   GLAPGASPRGARFQVTAPSDAHVSEFLASLVVAVATSQPIACVAENAFVRTTGVARRLA
FT                   SHAIAVAGDGFVVAEGSVSALAMLLDTWQAEAVWMAFGGEERIDVLEAAVRGPRWWALD
FT                   RAHGPLDTAGAQLGCVMRVALSHASLEAFADVHTVLRFLDYARGRIEVPAR"
     ttggcttgct acgcggactc cggcaccgtt agtcggcaag ggcgatcaca tccatctccc        60
     ctggtgacca acaactccag cgcgggcgag cgccaaacca tgcgtttcga tcttgacgtt       120
     cagtggtgcc ccgcgggtct cgcgcctggc gcctcgccgc gtggcgctcg gttccaggtc       180
     acggcgccgt cggacgcgca cgtctccgag ttcctcgcgt ccctggttgt cgcagtcgct       240
     acgagtcagc cgatcgcgtg cgtggccgag aatgctttcg ttcgaacgac gggagtcgcg       300
     cgccgccttg cgtctcacgc gattgccgtg gccggagacg gcttcgtggt cgcggaggga       360
     agcgtctcag cactcgcgat gctgctcgat acgtggcagg ccgaggcggt ctggatggcg       420
     ttcggtggcg aggaacgcat cgacgtactc gaggcagccg tgcgtggccc gcgttggtgg       480
     gcacttgacc gcgcccatgg tccccttgat accgccggcg cgcagctcgg gtgcgtgatg       540
     cgtgtcgcgc tgagccacgc gtctctggag gccttcgccg acgtgcacac cgtgctgcgg       600
     ttcctagatt atgcgagagg gcggatcgag gtgcctgcac gttga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page