(data stored in ACNUC7421 zone)

EMBL: CP000251.PE458

CP000251.PE458       Location/Qualifiers
FT   CDS_pept        complement(543645..544220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80236"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80236.1"
FT                   /translation="MVPLENTATVLLADYRNAPVRYILDTAAGLVTEARAVDPAAAEAG
FT                   ALQRGVVGFGAWQKLHFRQRRRVFMAVYSTGEQLVLRIGTFEVRWPDPELRVRRSAVFA
FT                   HVKRFRVYRADQLILSFLYPFLDWDAFPDNGDILTYAESMTRTPNVTMRTILRFKVIST
FT                   GIDPMSERYVEEVAAALHEADRRTGKEP"
     atggttccgc tcgagaacac ggcgaccgtc ctcctggccg attaccggaa cgcgccggtg        60
     cgctacatcc tcgacacagc cgccgggttg gtgaccgagg cacgcgccgt cgatccggcg       120
     gcggccgagg ccggcgcgct gcaacgaggg gtggtcggct tcggcgcgtg gcaaaagctc       180
     cactttcggc agcgccgacg ggtgttcatg gcggtctact ccacgggtga acagctcgtg       240
     ctccgcatcg ggacgttcga ggtgcgctgg cccgacccag aactgcgcgt aaggcgttca       300
     gccgtgttcg cccacgtgaa acgctttcgc gtctatcgcg ccgaccagct cattctctcg       360
     ttcctgtatc ccttcctcga ttgggacgcg ttcccagaca acggcgacat cctcacgtac       420
     gcggagagca tgaccaggac gccgaacgtc acgatgcgaa cgatcctgcg cttcaaggtg       480
     atctccaccg ggatcgaccc catgagcgag cgctacgtgg aggaggtcgc tgcggctctc       540
     cacgaggccg accggcgaac ggggaaggag ccgtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page