(data stored in ACNUC7421 zone)

EMBL: CP000251.PE46

CP000251.PE46        Location/Qualifiers
FT   CDS_pept        complement(56823..58817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79824"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79824.1"
FT                   /translation="MLAPLALALALASPPAPPSADPGPAPAAAIATAAPGSLSPAANAA
FT                   PDPAYLAELVARARALRLAEDPGWLKLGHWRRRPLGGWKSEADGAKFFRARDGKTDPAA
FT                   ELEATLAGFLDAGPKADELDDAQCRFPARFAFLGGRLGFDLARLPPRRCPRFEDFYGKI
FT                   RPQGVTVVFSSYYLNNPASAFGHTLLRLDKAPEAIGGKHFELLDYGVDYAATVDTGNAV
FT                   LYAAKGLLGFFKGEFKYYPYYYKVREYGDYESRDLWEYDLELTQGEVALLGAHVWELGG
FT                   TWFDYWYLDENCSYHVLGALEAAAPRLDLLSHVGRAVVLPSDTVVALFRNPGLVRRVHY
FT                   RPSIRTQFEARARGLSGAELREVEALAGDPAAPLAAGTPPDGQAKVLDAAVDLLDLRHA
FT                   RELIRGLEPKAAQDRQALLERRAALGVASAPLALPVPEARRPERGHGSLRLGVGGGAAD
FT                   GQGGTVLLDARLALHDLGDPADGYPPTAQIEFLPTRLRWTPRERRVDLDDVALVRIVSL
FT                   SPVTRFDARPSWKASFGATTVRDRGCDRCVAFAGDFGGGLAAALPGGLDLAATGDLELR
FT                   ASPRLSGAGGTGWRPGIGPSALARLRLGSRAVLLADARWRWLPEAAPRTTWSWGGALRL
FT                   HLARDLSLAFEARRQPLATEAAALVLGYF"
     atgctcgccc cgctcgccct cgccctcgcg ctcgcgtccc cgcccgcccc gccgtccgcg        60
     gatcccggcc cggcgcccgc ggccgcgatc gccaccgcgg cgccgggctc cctgagcccg       120
     gccgcgaacg ccgcgccgga ccccgcctac ctcgccgagc tggtcgcgag ggcccgcgcg       180
     ctccggctgg cggaggatcc ggggtggctg aagctggggc actggcgccg ccgcccgctg       240
     ggcggctgga agagcgaggc cgacggcgcc aagttcttcc gggcccgcga cgggaagacc       300
     gatccggccg ccgagctgga ggcgacgctg gccggcttcc tcgacgccgg cccgaaggcg       360
     gacgagctcg acgacgcgca gtgccgcttc ccggcgcgct tcgcgttcct gggcgggcgg       420
     ctcggcttcg acctcgcccg cctgccgccg cgccgctgcc cgcgcttcga ggacttctac       480
     gggaagatcc ggccgcaggg cgtgacggtg gtgttctcgt cctactacct caacaacccc       540
     gcctcggcgt tcggccacac cctgctccgg ctcgacaagg cgccggaggc gatcggcggc       600
     aagcacttcg agctgctcga ctacggggtg gactacgccg ccaccgtgga caccgggaac       660
     gcggtgctct acgcggcgaa ggggctgctc ggcttcttca agggcgagtt caagtactac       720
     ccgtactact acaaggtccg cgagtacggg gactacgagt cccgggatct gtgggagtac       780
     gacctcgagc tcacgcaggg cgaggtggcg ctgctcggcg cgcacgtctg ggagctgggc       840
     ggcacctggt tcgactactg gtacctcgac gagaactgca gctaccacgt gctcggcgcg       900
     ctcgaggccg ccgcgccgcg gctcgacctc ctctcgcacg tgggccgcgc ggtggtgctg       960
     ccctccgaca ccgtggtggc gctgttccgc aacccgggcc tggtgcggcg cgtccactac      1020
     cgcccctcca tccgcacgca gttcgaggcg cgggcccgcg ggctctccgg cgccgagctg      1080
     cgcgaggtgg aggcgctcgc cggcgacccg gccgcgccgc tcgccgcggg gaccccgccg      1140
     gacgggcagg cgaaggtgct cgacgcggcg gtggacctgc tcgacctccg ccacgcgcgc      1200
     gagctcatcc gcggcctcga gccgaaggcg gcgcaggacc ggcaggcgct gctcgagcgg      1260
     cgggccgcgc tgggggtggc gagcgcgccg ctcgcgctcc ccgtcccgga ggcgcgccgc      1320
     cccgagcgcg gccacggctc gctgcgcctc ggggtgggcg gcggcgccgc cgacggccag      1380
     ggcgggacgg tgctcctcga cgcgcgcctg gcgctccacg acctcggcga tcccgccgac      1440
     ggctacccgc ccaccgcgca gatcgagttc ctccccacgc gcctgcgctg gacgccgcgc      1500
     gagcggcggg tggacctcga cgacgtggcg ctcgtgcgca tcgtctcgct cagcccggtg      1560
     acgcgcttcg acgcgcggcc gtcctggaag gcgagcttcg gcgccaccac cgtgcgcgac      1620
     cgcggctgcg accggtgcgt cgcgttcgcg ggcgacttcg gcggcgggct ggcggcggcg      1680
     ctgccgggcg gcctcgacct cgccgccacc ggcgacctcg agctgcgcgc ctcgccccgg      1740
     ctctccggcg cgggcggcac tggctggcgc ccggggatcg gcccctcggc gctggcgcgg      1800
     ctccgcctcg gatcgcgcgc ggtcctgctc gccgacgcgc gctggcgctg gctgcccgag      1860
     gccgcgcccc gcaccacctg gtcgtggggc ggcgcgctcc ggctgcacct cgcgcgcgac      1920
     ctctcgctgg cgttcgaggc ccgccggcag ccgctcgcca ccgaggccgc cgcgctggtg      1980
     ctcggctact tctag                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page