(data stored in ACNUC7421 zone)

EMBL: CP000251.PE460

CP000251.PE460       Location/Qualifiers
FT   CDS_pept        544919..545518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80238"
FT                   /db_xref="GOA:Q2IN56"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80238.1"
FT                   /translation="MTVALTAAGFGALHAVSGPDHLLSVAPLSVGRRRQAWRIGLVWGL
FT                   GHAAGTAVAAAVLLALLSGAGLHVVDAWAERAAGLALVAMGAANLLALRRRRGMAAAGA
FT                   RDVRPAVFSVGLVHGVTGAAALLLVVPAVNAGASVKVLAILGFVAGSTAAMAALTAAIA
FT                   ALSAAAAPRLALATWRLPALASVVSVAVGIGWAIAA"
     atgaccgtcg ccctcaccgc cgcaggtttc ggcgcgctgc acgccgtctc cggtcccgac        60
     cacctgctca gcgtggcgcc gctctcggtg gggcgcaggc gccaggcctg gcgcatcggg       120
     ctggtgtggg ggctcgggca cgccgccggc acggccgttg ccgcggcggt gctgctcgcc       180
     ctcctgtccg gcgccgggct gcacgtggtg gacgcctggg ccgagcgcgc ggcaggcctg       240
     gcgctcgtgg cgatgggcgc ggcgaacctg ctggcgctcc gccgccggcg ggggatggcg       300
     gcggcggggg cgcgcgacgt tcgcccggcg gtcttctcgg tcggcctcgt gcacggggtc       360
     accggcgcgg cggcgctgct gctggtggtc ccggcggtga atgcgggcgc ctcggtgaag       420
     gtgctcgcca tccttggctt cgtcgcgggc agcactgccg ccatggctgc gctcaccgct       480
     gccatcgccg cgctctccgc ggcggccgcg ccccggctcg cgctcgccac ctggcggctc       540
     ccggcgctcg cctcggtcgt ctcggtggcg gtcgggatcg gctgggcgat cgcggcctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page