(data stored in ACNUC7421 zone)

EMBL: CP000251.PE467

CP000251.PE467       Location/Qualifiers
FT   CDS_pept        555489..556682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80245"
FT                   /db_xref="GOA:Q2IN59"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80245.1"
FT                   /translation="MSAPASAPVLLGYGTRPLPFPAGVPARVLAAPPAPAVADLPAALD
FT                   AALAHPEGARPLPEVAGPRTRVLVIVSDASRDEPRAELFAAVRRALAVVPDDHLTLAVA
FT                   NGTHGPGPLEALGLPDDVLRRHRVVNHDARDEASMVEMGRTSRGTRLRVNRCVAESDLV
FT                   VTTGRVKPHYFAGWGGGAKGIFPGLGHDDDIRQNHKLKADPASSLGRADGNPCREDLEE
FT                   AVRRLGRDTYMLNVVEAGGVVMGAVAGDVLYAHRAGVRMARPWCEVAAEPADVVVVSAP
FT                   LPVSGSLYQASKLVPPAGMLLREGGVVVVCAECPGGVGPLRTVNEGIFQLGVRRFLPER
FT                   YTLLLVSGMPEATVRETYAAFAPSLEAALASAREIVGKPEPDVLVLPDAGDLVPRRR"
     atgagcgcgc ccgcgtccgc ccccgtcctg ctcggctacg gcacccgccc gctcccgttc        60
     ccggccggcg tgccggcgcg cgtgctcgcc gccccgcccg cgccggcggt ggccgacctg       120
     cccgccgcgc tggacgcggc gctcgcgcac cccgagggcg cccgtccgct gccggaggtg       180
     gccggcccgc gcacgcgggt gctggtgatc gtgagcgacg cctcgcgcga cgagccgcgc       240
     gccgagctgt tcgcggcggt ccggcgtgcg ctcgcggtgg tccccgacga ccacctcacg       300
     ctcgcggtcg cgaacggcac gcacgggccc gggccgctcg aggcgctcgg gctgccggac       360
     gacgtgctcc ggcgccaccg cgtggtgaac cacgacgcgc gcgacgaggc ctccatggtg       420
     gagatgggcc ggaccagccg cggcacgcgc ctgcgggtga accggtgcgt ggcggagagc       480
     gacctcgtcg tcaccaccgg ccgggtgaag ccgcactact tcgccggctg gggcggcggc       540
     gccaagggga tcttccccgg gctcggccac gacgacgaca tccggcagaa ccacaagctc       600
     aaggccgacc ccgcctccag cctgggccgg gccgacggca acccgtgccg cgaggacctg       660
     gaggaggcgg tccggcggct cgggcgcgac acgtacatgc tgaacgtggt ggaggcgggc       720
     ggggtggtga tgggggcggt ggcgggcgac gtgctctacg cgcaccgcgc cggcgtgcgc       780
     atggcgcggc cctggtgcga ggtcgccgcc gagccggccg acgtggtggt ggtctcggcg       840
     ccgctgccgg tctccggcag cctctaccag gcctcgaagc tggtcccgcc ggcggggatg       900
     ctgctgcggg agggcggcgt ggtcgtcgtc tgcgccgagt gccccggcgg cgtggggccg       960
     ctccggaccg tcaacgaggg catcttccag ctgggcgtcc ggcgcttcct gccggagcgg      1020
     tacacgctgc tcctcgtctc gggcatgccc gaggccaccg tgcgcgagac ctacgcggcg      1080
     ttcgcgccct cgctcgaggc ggcgctggcg agcgcgcggg agatcgtcgg caagcccgag      1140
     ccggacgtcc tcgtccttcc ggacgccggc gacctcgtcc cgcggcggcg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page