(data stored in ACNUC7421 zone)

EMBL: CP000251.PE47

CP000251.PE47        Location/Qualifiers
FT   CDS_pept        complement(58893..59390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79825"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79825.1"
FT                   /translation="MNRITLALVAALLAVPAAAADQTASAIKGTGRYGTAGCGLGSMAF
FT                   GNTPGAVQILAATTNGTFGNQTFGITTGTSNCGSGVFTAGTKNFVDANREALAKDISRG
FT                   EGEAIGALTVINACENSHAVGAALQKNFKAIFPSESASNEDVTKAILDTLHGDAALGCG
FT                   RS"
     atgaaccgca tcacgctcgc gctcgtcgcc gcgctgctcg ccgtgccggc cgccgccgct        60
     gatcagaccg cctccgccat caagggcacc ggccgctacg gcaccgccgg ctgcggcctc       120
     ggctccatgg cgttcggcaa caccccgggc gcggtccaga tcctggccgc caccaccaac       180
     ggcaccttcg gcaaccagac cttcggcatc accaccggca cctcgaactg cggcagcggc       240
     gtgttcaccg ccggcaccaa gaacttcgtg gacgcgaacc gcgaggcgct cgccaaggac       300
     atctcccgcg gcgagggcga ggccatcggc gcgctcaccg tgatcaacgc ctgcgagaac       360
     tcgcacgcgg tcggcgccgc gctgcagaag aacttcaagg cgatcttccc gagcgagagc       420
     gcctcgaacg aggacgtgac caaggcgatc ctcgacacgc tgcacggcga cgcggccctc       480
     ggctgcggcc gcagctag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page