(data stored in ACNUC7421 zone)

EMBL: CP000251.PE475

CP000251.PE475       Location/Qualifiers
FT   CDS_pept        complement(564262..564789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0477"
FT                   /product="peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80253"
FT                   /db_xref="GOA:Q2IN70"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80253.1"
FT                   /translation="MARIAVFGIGNVLTGDDAVGPYVVKVLEARWELPGVEVVDAGTPG
FT                   LDLTAYFAGLDAAILVDAVKARAAPGELRTYSREDLVKRSPVLAVSPHEPGLREAVMNA
FT                   EFMGVCPATVRLVGVVAERTDLGCALSPSVQAAVPAAVEQVLSELRALGVAPRPRDPPV
FT                   EPDLWWEKGRAG"
     gtggcgcgca tcgcggtctt cggcatcggc aacgtgctca ccggcgacga cgccgtcggg        60
     ccgtacgtgg tgaaggtgct ggaggcgcgc tgggagctgc ccggcgtcga ggtggtggac       120
     gccggcacgc ccggcctcga cctcaccgcc tacttcgccg gcctcgacgc ggccatcctg       180
     gtggacgcgg tgaaggcgcg cgccgcgccc ggcgagctgc ggacgtactc gcgcgaggac       240
     ctggtgaagc gctcgccggt gctggcggtg agcccgcacg agcccgggct gcgcgaggcc       300
     gtgatgaacg cggagttcat gggcgtgtgc ccggccacgg tgcgcctggt gggcgtggtg       360
     gccgagcgga ccgacctcgg ctgcgcgctc tctccctcgg tgcaggccgc ggtgccggcg       420
     gcggtcgagc aggtgctgtc cgagctgcgg gcgctgggcg tcgcgccgcg gccccgcgac       480
     ccgccggtcg agccggacct gtggtgggag aagggccggg ccgggtag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page