(data stored in ACNUC7421 zone)

EMBL: CP000251.PE476

CP000251.PE476       Location/Qualifiers
FT   CDS_pept        complement(564883..566616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0478"
FT                   /product="Nickel-dependent hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80254"
FT                   /db_xref="GOA:Q2IN69"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80254.1"
FT                   /translation="MSKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWIFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNLIVTAHTLHDH
FT                   IVHFYQLSALDWVDVTSALKADPVKAAQLAESISSWPGNSKHELAAVKARLEGFVKAGQ
FT                   MGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALEIQRKANMAVAILGSKTPNIQNLAVGG
FT                   VANAINLDSPAALNMEKLYQVKTLIDEVATFVQQCYLPDVAAIGGFYPDWFKYGAGVTN
FT                   YLSVPELPLDEKMSKFDIPGGVLWNGKLELAHKLAGWNDDYLKQNVTESIAHAHYDGAW
FT                   AKGPWEEDDKPKFAGEWKHETPAPDRYTWVKAPRLEGKPVQVGPLACVLVGLASGHEPT
FT                   TRWATAAIGAVKAIHKIDLTPAHLHSTLGRHAARAIRAAMMAEMAQKQWKLLVENIGKG
FT                   DTRIWVDPMANLKPGIYKGVGFHEAPRGTLSHWCVIEADKKGMKLKNYQCVVPSTWNAG
FT                   PRDASGTLGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGDEIARVKV
FT                   L"
     atgagcaagc tcatcaccat cgacccggtc acgcgcatcg agggtcacct ccgcatcgac        60
     gtcgaggtag acgggggcgc ggtcaagaac gcatggtcct cgggcaccat gtggcgcggc       120
     atcgagacca tcctccaggg ccgcgatccc cgcgacgcct ggatcttcac ccagcgcatc       180
     tgcggcgtgt gcaccaccgt gcacgcgatc gcctcggtgc gcagcgtgga gaacgcgctc       240
     ggcctcgaga tcccgctgaa cgcgcagctc atccgcaacc tgatcgtcac ggcgcacacg       300
     ctgcacgatc acatcgtcca cttctaccag ctgtccgcgc tggactgggt ggacgtgacc       360
     agcgccctga aggccgaccc ggtgaaggcg gcgcagctcg ccgagtcgat ctccagctgg       420
     ccgggcaact cgaagcacga gctcgcggcg gtgaaggcgc gcctcgaggg cttcgtcaag       480
     gccggccaga tgggcatctt caccaacggc tactggggcc acccggcgat gaagctctcg       540
     ccggaggtga acctgctcgc ggtcgcgcac tacctccagg cgctggagat ccagcgcaag       600
     gccaacatgg cggtggcgat cctcggctcg aagacgccga acatccagaa cctggcggtg       660
     ggcggcgtcg ccaacgccat caacctggac agcccggccg cgctgaacat ggagaagctg       720
     taccaggtga agaccctcat cgacgaggtc gccaccttcg tgcagcagtg ctacctgccc       780
     gacgtcgccg ccatcggcgg cttctacccg gactggttca agtacggcgc gggggtgacg       840
     aactacctct cggtgcccga gctcccgctg gacgagaaga tgtcgaagtt cgacatcccg       900
     ggcggcgtgc tctggaacgg caagctcgag ctggcgcaca agctggcggg ctggaacgac       960
     gactacctga agcagaacgt gacggagtcg atcgcgcacg cccactacga cggcgcctgg      1020
     gccaagggcc cgtgggagga ggacgacaag ccgaagttcg ccggtgagtg gaagcacgag      1080
     acgcccgcgc ccgaccgcta cacctgggtg aaggcgccgc gcctcgaggg caagccggtg      1140
     caggtcgggc cgctcgcctg cgtgctggtg ggcctcgcct ccggccacga gcccaccacc      1200
     cggtgggcca ccgcggccat cggcgcggtg aaggcgatcc acaagatcga cctcaccccg      1260
     gcgcacctcc actccacgct cggccgccac gcggcgcgcg ccatccgcgc ggccatgatg      1320
     gccgagatgg cccagaagca gtggaagctc ctggtcgaga acatcggcaa gggcgacacg      1380
     cgcatctggg tggacccgat ggcgaacctg aagcccggca tctacaaggg cgtcgggttc      1440
     cacgaggcgc cgcgcggcac gctctcgcac tggtgcgtga tcgaggccga caagaagggc      1500
     atgaagctga agaactacca gtgcgtcgtg ccctcgacct ggaacgccgg cccgcgcgac      1560
     gcgagcggga ccctcgggcc ctacgagaag tcgctcgtcg gcaaccccat cgccgatccg      1620
     aagctgccgc tcgaggcgct ccgcacgatc cactcgttcg acccgtgcct cgcctgcgcc      1680
     atccacacgg tggacgcgga gggtgacgag atcgcccggg tgaaggtgct gtag            1734
//

If you have problems or comments...

PBIL Back to PBIL home page