(data stored in ACNUC7421 zone)

EMBL: CP000251.PE479

CP000251.PE479       Location/Qualifiers
FT   CDS_pept        complement(568831..569955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0481"
FT                   /product="hydrogenase (NiFe) small subunit (hydA)"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80257"
FT                   /db_xref="GOA:Q2IN73"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80257.1"
FT                   /translation="MDNIGSQMISGPETKGVSRRDFIKVCSVAAAAVGLPAWAGEKMAE
FT                   NVGKKKPSVVWLHFQECTGCTESLLRTSHPDVGALILDLVSVDYHETLFAAAGKQIEEA
FT                   LESAKKAGGYVLVVEGAIPKKDDGIYCMVGGKTAVDSLVECAEKAAAVICIGSCSSWGG
FT                   VPSAAPNPTQAVGAPEILREKGIKKPVVTLPGCPANPYNLLGTVLQFATFGTLPKLDEK
FT                   GRPAFAYGRVIHEDCPRRPHFDAGRFAQAYGDEGHRNGWCLYKIGCKGPQTHANCSLLS
FT                   FCEVPGAWPIGIGHPCVGCTEQGIVFNVPINQNLPIEHPTAPMAYPAIHPEHGVVGGSP
FT                   VAVGLGGAVIGALVGAGVVASRKMAAADDADGKE"
     atggacaata tcggctccca gatgatcagc ggcccggaga ccaagggcgt ctctcgccgt        60
     gacttcatca aggtgtgcag cgtcgctgcc gccgcggtcg gcctgcccgc ttgggccggc       120
     gagaagatgg cggagaacgt cggcaagaag aagccgtcgg tcgtctggct ccacttccag       180
     gagtgcaccg gctgcaccga gtcgctcctg cggacgagcc acccggacgt gggcgcgctg       240
     atcctcgacc tcgtctcggt ggactaccac gagaccttgt tcgccgcggc gggcaagcag       300
     atcgaggagg cgctcgagtc cgcgaagaag gcgggcggct acgtgctcgt ggtcgagggc       360
     gccatcccga agaaggacga cggcatctac tgcatggtcg gcggcaagac cgcggtggac       420
     tccctggtcg agtgcgccga gaaggcggcg gcggtgatct gcatcggctc ctgctcgagc       480
     tggggcggcg tgccgtcggc ggcgccgaac ccgacgcagg cggtgggcgc gccggagatc       540
     ctgagggaga aggggatcaa gaagccggtg gtgacgctcc ccggctgccc ggcgaacccg       600
     tacaacctcc tcggcaccgt gctgcagttc gcgacgttcg ggacgctgcc caagctggac       660
     gagaagggcc gccccgcgtt cgcctacggc cgcgtcatcc acgaggactg cccgcggcgc       720
     ccgcacttcg acgccggccg cttcgcgcag gcctatggcg acgagggcca ccgcaacggc       780
     tggtgcctct acaagatcgg ctgcaagggg ccgcagacgc acgccaactg ctcgctcctc       840
     tcgttctgcg aggtgccggg cgcgtggccc atcggcatcg gccacccgtg cgtcggctgc       900
     accgagcagg gcatcgtctt caacgtgccc atcaaccaga acctgcccat cgagcacccc       960
     accgccccga tggcctaccc ggccatccac cccgagcacg gcgtggtggg cggcagcccg      1020
     gtcgcggtcg gtctgggcgg cgcggtgatc ggcgccctgg tcggcgcggg tgtggtggcc      1080
     tcccggaaga tggcggccgc cgacgacgca gacgggaagg agtag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page