(data stored in ACNUC7421 zone)

EMBL: CP000251.PE48

CP000251.PE48        Location/Qualifiers
FT   CDS_pept        59616..60419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0048"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79826"
FT                   /db_xref="GOA:Q2ILZ6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79826.1"
FT                   /translation="MALKIVVTAKRVEDPESKIRVKPDGSGIVTDGVNYKINPFDEIAV
FT                   EEALRLKERHGGEVVVASIGGERSQTEIRAALAMGADRGILVRHDGPLDPVVVSALLAK
FT                   VVEQEKPDLVILGKQSIDDDQNQAGQYLAERLGWPQGTFASKTESLESEAEQKKEPGLV
FT                   LSADGKALTVVREVDGGVETLELGLPAVVTTDLRLNKPRFASLPGIMKAKKKPLQELAA
FT                   ASLGVDLAPQVVVKRLSEPPARKGGVKVADVEELWKKLHDEAKVL"
     atggccctca agatcgtggt gaccgcgaag cgcgtcgagg acccggagtc gaagatccgc        60
     gtgaagccgg acggctccgg gatcgtgacc gacggcgtca actacaagat caacccgttc       120
     gacgagatcg ccgtcgagga ggcgctccgg ctgaaggagc gccacggcgg cgaggtggtg       180
     gtcgcgtcca tcggtgggga aaggtcgcag acggagatcc gcgccgcgct cgccatgggc       240
     gccgaccgcg ggatcctcgt ccgccacgac ggcccgctcg atccggtggt ggtgtcggcg       300
     ctgctcgcca aggtggtcga gcaggagaag cccgacctcg tcatcctcgg caagcagtcc       360
     atcgacgacg accagaacca ggccggccag tacctggccg agcggctcgg ctggccgcag       420
     ggcacgttcg cctcgaagac cgagagcctg gagagcgagg ccgagcagaa gaaggagccg       480
     ggcctcgtgc tctccgccga cggcaaggcg ctcaccgtcg tccgcgaggt ggacggcggg       540
     gtggagacgc tggagctggg cctgccggcg gtggtgacca ccgacctgcg cctcaacaag       600
     ccgcgcttcg cctcgctgcc cggcatcatg aaggccaaga agaagccgct ccaggagctc       660
     gccgccgcgt cgctgggggt ggacctcgcg ccgcaggtgg tggtgaagcg cctctccgag       720
     ccgcccgccc gcaagggcgg cgtgaaggtg gccgacgtcg aggagctctg gaagaagctg       780
     cacgacgagg cgaaggtcct ctag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page