(data stored in ACNUC7421 zone)

EMBL: CP000251.PE481

CP000251.PE481       Location/Qualifiers
FT   CDS_pept        571036..572733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0483"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80259"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80259.1"
FT                   /translation="MNASCFPYASLLASIAVLTAAAPGPARAAEAAPPGVASLRRAEAR
FT                   FAPVDLKVDLSKLPASERTALARLVEAGRIMDALFLRQVWAGNEALLLRLVEDRSPLGE
FT                   ARLRLFLRNKGPWDRLEEDRAFLPGIPEKPQQASFYPAGATKDEVERWAAGLAPEEKDR
FT                   AMGFFTTVRRDAAGKLVAVPYSLEYQGELARAAALLREAAAATQDAGLRTFLEARAAAF
FT                   VGNAYRDSDVAWMRLDSAVEPTIGPYEVYEDGWFNAKAAFEAFIGVRDDAETAKVARFA
FT                   AELQGIEDALPIDAAFKNPKIGALAPIRVINEVYAGGDAAKGVQTAAYNLPNDEWVTRT
FT                   MGSKRVMLKNVQEAKFQKVLQPVARRLLSPADRAHVAFDPFFTHILMHELVHGLGPHHA
FT                   TVNGQEVTVRAALAETYSALEEAKADVAGLFALEKLLDDGKLDRRMRDTLYPTFLCGAF
FT                   RSIRFGLNEAHGKGMAIQINWLLDHGAIVARKDGTFAVDGAKMRDAVAGLTREIMTIQA
FT                   KGDRAAAKAMLEKLGVVRPEVARALARIEDLPVDIAPRFVTADALTAR"
     atgaacgcct cgtgcttccc gtacgcctcg ctgctcgcct cgatcgccgt cctcaccgcc        60
     gccgcgccgg gtccagcgcg cgccgccgag gcggcgcccc cgggcgtcgc ctcgctccgc       120
     cgcgccgagg cccgcttcgc gccggtggac ctgaaggtgg atctctcgaa gctgcccgcg       180
     tcggagcgca cggcgctcgc ccgcctggtc gaggccggcc ggatcatgga cgcgctgttc       240
     ctgcggcagg tgtgggccgg caacgaggcg ctgctgctcc ggctggtcga ggatcgcagc       300
     ccgctcggcg aggcgcggct ccgcctgttc ctgcgcaaca agggcccgtg ggaccggctc       360
     gaggaggatc gcgccttcct gccggggatc ccggagaagc cgcagcaggc gagcttctac       420
     ccggcgggcg ccacgaagga cgaggtggag cggtgggcgg ccgggctcgc gcccgaggag       480
     aaggaccggg ccatgggctt cttcaccacc gtccgccgcg acgcggccgg caagctcgtg       540
     gcggtgccgt acagcctcga gtaccagggc gagctggcgc gcgcggcggc gctgctgcgc       600
     gaggcggccg cggcgaccca ggacgcgggg ctgcggacgt tcctcgaggc gcgcgcggcg       660
     gcgttcgtcg gcaacgccta ccgcgactcc gacgtggcct ggatgcgcct cgactcggcg       720
     gtggagccga ccatcgggcc ctacgaggtc tacgaggacg gctggttcaa cgccaaggcg       780
     gcgttcgagg cgttcatcgg cgtgcgggac gacgccgaga ccgcgaaggt ggcccgcttc       840
     gccgccgagc tgcagggcat cgaggacgcg ctgcccatcg acgcggcctt caagaacccg       900
     aagatcggcg cgctcgcgcc catccgcgtg atcaacgagg tctacgcagg cggcgacgcc       960
     gccaagggcg tgcagaccgc ggcctacaac ctcccgaacg acgagtgggt cacgaggacc      1020
     atggggtcga agcgggtgat gctgaagaac gtgcaggagg cgaagttcca gaaggtgctg      1080
     cagccggtgg cgcgccgcct gctctcgccg gcggaccggg cccacgtcgc gttcgacccg      1140
     ttcttcacgc acatcctcat gcacgagctg gtgcacgggc tcggcccgca ccacgccacc      1200
     gtgaacggcc aggaggtcac ggtgcgcgcc gcgctggcgg agacctacag cgcgctcgag      1260
     gaggcgaagg ccgacgtggc ggggctgttc gcgctggaga agctgctcga cgacggcaag      1320
     ctcgaccggc ggatgcgcga cacgctctac cccaccttcc tctgcggcgc gttccgctcg      1380
     atccgcttcg ggctgaacga ggcccacggc aagggcatgg ccatccagat caactggctg      1440
     ctcgaccacg gggcgatcgt ggcgcgcaag gacgggacgt tcgcggtgga cggcgcgaag      1500
     atgcgcgacg ccgtcgccgg gctcacccgc gagatcatga ccatccaggc gaagggcgac      1560
     cgcgccgccg cgaaggccat gctggagaag ctgggcgtgg tccggcccga ggtggcccgc      1620
     gcgctcgcgc ggatcgagga cctgccggtg gacatcgcgc cccggttcgt caccgccgac      1680
     gcgctcaccg cgcggtag                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page